DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9220 and Csgalnact1

Sequence 1:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:NP_001100779.1 Gene:Csgalnact1 RGDID:1307618 Length:530 Species:Rattus norvegicus

Alignment Length:610 Identity:142/611 (23%)
Similarity:234/611 (38%) Gaps:171/611 (28%)


  Fly   257 QYILRHNSSGRNAYTGKLKRK--------------------EIHNAITL------HPIKQAPLMY 295
            |.:|:........|...|||:                    :..:|.:|      .|..||.::.
  Rat    56 QAVLQEREEQHRNYVNSLKRQIAQLKDELQARSEQLRSGQDQASDATSLRSGWDPEPKAQADILA 120

  Fly   296 RLHSYVQGLKAEEMRQESLLLHRDIKRMAKYLEVPDESTYMLPSVSPESDSTKRHFQDHNILGIS 360
            .|...|.  |||        :|..:|...:|..||.:| :.|..|........||          
  Rat   121 FLRGQVD--KAE--------VHAGVKLATEYAAVPFDS-FTLQKVYQLETGLTRH---------- 164

  Fly   361 PELNKFVPASTDDLLDWSFIARSLYSASSANPKQK-IDSAMREGLEDAITEVMENINNYSRQRGR 424
                                           |::| :....|:.|.:||...:|::|:       
  Rat   165 -------------------------------PEEKPVRKDKRDELVEAIESALESLNS------- 191

  Fly   425 VIEFRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVRRHLYVQRAFTGIFVKEVDEDFY 489
            .:|.......|...|.:.|         ||:..|.|..       || :..|.|    :...:|.
  Rat   192 PVESSPHQRPYTAADFIEG---------IYRTERDKGT-------LY-ELTFKG----DHKHEFQ 235

  Fly   490 NVTLQQSLLGSLFQNGMARLSSHFTMPSGLLSPTQDKIVFVLPIAGRLGTFERFLRTYERVCVRG 554
            .:.|.:. .|.:.:....:|:...|:           |..::|:|.|:..|..|::.:..:|::.
  Rat   236 RLVLFRP-FGPIMKVKKEKLNMANTL-----------INVIVPLARRVDKFRHFMQNFREMCIQQ 288

  Fly   555 EQHCDLLVVIFGSPDELGDHLQLLHDLHARHVYQQVNWIQRSSAFSRGVALDVAARSSYIRQEDI 619
            :....|.||.||. :|:.:...:|.:......::...:||.:..||||..|||.||  :.:..::
  Rat   289 DGRVHLTVVYFGK-EEMNEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGAR--FWKGSNV 350

  Fly   620 ILFI-DVDMVFEVETLQRVRMHTQRGKQVYLPIVFSQYDPQRRSGDAGGSEDEGETPRIDD---- 679
            :||. |||:.|..|.|...|::||.||:|:.|::||||:|    |...|..|  ..|.::.    
  Rat   351 VLFFCDVDIYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNP----GIIYGHHD--AVPALEQQLVI 409

  Fly   680 --ERGYFRQFGFGICAIYKSDILDEDINGFDKDITGWGLEDVKFLEKIVRVGTRQRGFLANTAEL 742
              |.|::|.||||:...|:||.:  :|.|||.||.|||.|||....|.:.               
  Rat   410 KKETGFWRDFGFGMTCQYRSDFI--NIGGFDLDIKGWGGEDVHLYRKYLH--------------- 457

  Fly   743 AMDYNEAAEQWRRLSVFRAPDPTLVHIYHDISCDVQLDAPQYNMCLGTKANSLGSTRLMEQLFHS 807
                       ..|.|.|.|...|.|::|:..|..:|...||.||:.:||        |.:..|.
  Rat   458 -----------SNLIVIRTPVRGLFHLWHEKHCMDELTPEQYRMCMQSKA--------MNEASHG 503

  Fly   808 SPENVQFAADFNRQKQQQQQQQQAR 832
            ....:.|..:.....::|:.:..::
  Rat   504 QLGMLVFRHEIEAHLRKQKLKASSK 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462
CHGN 221..799 CDD:283361 138/576 (24%)
Csgalnact1NP_001100779.1 Glyco_tranf_GTA_type 68..505 CDD:299700 138/574 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.