DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9220 and b4galnt3

Sequence 1:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster
Sequence 2:XP_004912790.1 Gene:b4galnt3 XenbaseID:XB-GENE-6051199 Length:1136 Species:Xenopus tropicalis

Alignment Length:370 Identity:90/371 (24%)
Similarity:155/371 (42%) Gaps:79/371 (21%)


  Fly   408 ITEVMENINNYSRQRGRVIEFRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVRRHLYV 472
            :...|..:|  .:.|| :.:.:.::....|.|.|||....|:|.|             ..||.::
 Frog   819 VAAFMRKLN--QKYRG-MYQLQNIINVEKRRDYLHGSRYFLELEL-------------KARHGHI 867

  Fly   473 QR--------AFTGIFVKEVDEDFYNVTLQ----QSLLGSLFQNGMARLSSHFTMPSGLLSPTQD 525
            ||        .:.|||.::.:::.....:.    :.|||:.::..:.       .||||....|.
 Frog   868 QRFAHYVYAPEWQGIFSEDNEQERAMKNMMWGSYRRLLGATWEPDLC-------WPSGLNWNPQA 925

  Fly   526 KIVFVLPIAGRLGTFERFLRTYERVCVRG--EQHCDLLVVIFGSPDELGDHLQLLHDLHARHV-- 586
            .:.|::||..:....::|:|..| :..:.  :...::::|.|.|.|     |.:...|...||  
 Frog   926 TVHFIVPIKNQARWVQKFIRDME-ILYQATLDSRFNVIIVDFNSTD-----LDVEAALRQSHVPS 984

  Fly   587 YQQVNWIQRSSAFSRGVALDVAARSSYIRQEDIILFI-DVDMVFEVETLQRVRMHTQRGKQVYLP 650
            ||   :::...:|.|...|.  |....::....|||: |:.|.|....:..:|.|...||.|:.|
 Frog   985 YQ---YVKLQGSFERSAGLQ--AGIDIVKNPHSILFLCDLHMHFPPSIIDSMRTHCVEGKMVFAP 1044

  Fly   651 IVFSQYDPQRRSGDAGGSEDEGETPRIDDERGYFRQFGFGICAIYKSDILDEDINGFD----KDI 711
            ||...              :.|.|||..:  ||:...|||:..|||||:  :.|.|.:    |: 
 Frog  1045 IVVRL--------------NCGATPRWPE--GYWEVNGFGLLGIYKSDL--DRIGGMNTQEFKE- 1090

  Fly   712 TGWGLEDVKFLEKIVRVGTR-QRGFLANTAELAMDYNEAAEQWRR 755
             .||.||.:.|::|::.|.. :|..:.|   ....|:.....|.|
 Frog  1091 -RWGGEDWELLDRIIQAGLEVERVAVRN---FYHHYHSKRGMWNR 1131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462
CHGN 221..799 CDD:283361 90/371 (24%)
b4galnt3XP_004912790.1 PA14 107..229 CDD:298777
Glyco_tranf_GTA_type <818..1125 CDD:299700 88/363 (24%)
WcaA 930..1129 CDD:223539 60/233 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.