DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp11 and Akp3

DIOPT Version :8

Sequence 1:NP_573047.1 Gene:Alp11 / 32496 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_073171.1 Gene:Akp3 / 64621 RGDID:621650 Length:562 Species:Rattus norvegicus

Alignment Length:509 Identity:193/510 (38%)
Similarity:264/510 (52%) Gaps:74/510 (15%)


  Fly    21 LALSVPMVEQVQPADELLSSHWLRQAQSQLRERLARTKDSIADVRQAKNVVMLLGDGLSITTLTA 85
            |:|||..||:..||      .|.::|...|  .:|:....|.  ..|||:::.||||:.:.|:||
  Rat    16 LSLSVIPVEEENPA------FWNQKAADAL--NVAKKLQPIQ--TSAKNLIIFLGDGMGVPTVTA 70

  Fly    86 ARILKGQRRGGRGEDAQLAVEQFPFSGLSKTYCIDEQTPDSACTATAYFGGVKTHSGTVGQSGS- 149
            .||||||..|..|.:..||::.||:..|||||.:|.|.||||.|||||..||||:..|:|.|.: 
  Rat    71 TRILKGQLEGNLGPETPLAMDHFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGVSAAA 135

  Fly   150 ---------GERVDSVLQWAQRAGKATGVVTTTRLTDASPAGAYAHVSRRG------------EE 193
                     |..|.||:..|::|||:.|||||||:..|||||.|.|...|.            :|
  Rat   136 RFDQCNTTFGNEVLSVMYRAKKAGKSVGVVTTTRVQHASPAGTYVHTVNRNWYGDADMPASALQE 200

  Fly   194 --LEIARQLVEEEPGRNLNVILGGGLGKF-----------------ADERRDGKDLLAQWRESNP 239
              .:||.||:.   ..::||||||| .|:                 ...|.|||:|:.:|...:.
  Rat   201 GCKDIATQLIS---NMDINVILGGG-RKYMFPAGTPDPEYPNDVNETGTRLDGKNLVQEWLSKHQ 261

  Fly   240 NGCFSRSLKEL-RNCTDATGT-LLGIFSDSHMSYHLAASKEL-PRLCDMAAAAIEKLERKSQEDG 301
            ...:..:.:|| :...|.:.| |:|:|......:.:.....: |.|.||..||:..|.|..:   
  Rat   262 GSQYVWNRQELIQKSLDPSVTYLMGLFEPVDTKFEIQRDPLMDPSLKDMTEAALHVLSRNPK--- 323

  Fly   302 NGYFVFIEGGRIDHGHHETRVGYALDEMVEFDAAVETVIQMTDPRDTLVVVTADHSHTLSMSGYA 366
             |:::|:||||||.|||......||.|.|..|:|:|...|:|..:|||.:|||||||..|..||.
  Rat   324 -GFYLFVEGGRIDRGHHLGTAYLALTEAVMLDSAIERASQLTSEQDTLTIVTADHSHVFSFGGYT 387

  Fly   367 KRGTPILGMDAQQRDVNGVPYSTLNYAIGKWQSLDKDGRRESPSKTLSPTSYTPSY-----IHGR 426
            .|||.|.|: |....::|.||:::.|..|....    |..|.|:.| ...|:.|||     :..:
  Rat   388 LRGTSIFGL-APLNALDGKPYTSILYGNGPGYV----GTGERPNVT-DAESHDPSYQQQAAVPVK 446

  Fly   427 KGVHSGEDVVVFAMGPQSHLFGGVMEQNLLPHIMGYAACLGNGLTLCNQDKDAD 480
            ...|.||||.:||.|||:||..||.|||.:.|:|.:|.|| ...|.|.....||
  Rat   447 SETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVMAFAGCL-EPYTDCGLAPPAD 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 175/448 (39%)
Akp3NP_073171.1 Alk_phosphatase 52..486 CDD:278666 175/448 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21898223
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.