DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp11 and Alp4

DIOPT Version :8

Sequence 1:NP_573047.1 Gene:Alp11 / 32496 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_524601.2 Gene:Alp4 / 43671 FlyBaseID:FBgn0016123 Length:596 Species:Drosophila melanogaster

Alignment Length:559 Identity:206/559 - (36%)
Similarity:289/559 - (51%) Gaps:95/559 - (16%)


  Fly     8 LAIL-FLLHALIPILALSV-----PMVEQV----------------QPADELLSSHW----LRQA 46
            |.|| |||.:|:......|     |::..:                :|.|   :..|    |||.
  Fly     4 LVILGFLLGSLVAFSWAGVTTQPPPLIRTLSAGGDIGPQFDVGKTKEPED---AEFWHNVGLRQL 65

  Fly    47 QSQLRERLARTKDSIADVRQAKNVVMLLGDGLSITTLTAARILKGQ-RRGGRGEDAQLAVEQFPF 110
            :..:::.....:||..  ::|:|:::.:|||:.|:|::|.||.||| .:.|.||:..|..:.||.
  Fly    66 EKTIKQAQRVKEDSYQ--KKARNIIIFIGDGMGISTISAGRIYKGQYLKHGYGEEETLVFDDFPN 128

  Fly   111 SGLSKTYCIDEQTPDSACTATAYFGGVKTHSGTVG-------QSGSGERVDSVLQWAQRAGKATG 168
            :|::|||.:|:|.||||.||||.|.|.|||.|.:|       ::|...||.||::|||:.||.||
  Fly   129 TGMAKTYNVDKQVPDSAGTATAIFSGSKTHYGAIGMDATRSKKNGQQGRVQSVMEWAQKEGKRTG 193

  Fly   169 VVTTTRLTDASPAGAYAHVSRR-------------GEELEIARQLVEEEPGRNLNVILGGGLGKF 220
            ||||||:|.|:||..|||:..|             |..::|||||||..||...|||||||:...
  Fly   194 VVTTTRITHATPAATYAHIYDRDWECDTEVPAESVGFHVDIARQLVENAPGNRFNVILGGGMSPM 258

  Fly   221 ----ADE---------------RRDGKDLLAQWRESNPNGCFSRSL----KELRNC-TDATGTLL 261
                |.|               |.|.::|.|:|...:.|.....:|    |:|.|. ......|:
  Fly   259 GILNASEVKTTIFEGPTETICTRGDNRNLPAEWLAHHANDTVPPALVHNRKDLLNVNVKKVDHLM 323

  Fly   262 GIFSDSHMSYHLAASKELPRLCDMAAAAIEKLERKSQEDGNGYFVFIEGGRIDHGHHETRVGYAL 326
            |:|.::|::|.:|.....|.|.:|...|:..|||  .::.||:.:.:||||||.|||......||
  Fly   324 GLFRNNHITYSIAREAGEPSLQEMTETALGILER--GDESNGFVLLVEGGRIDQGHHMNYARAAL 386

  Fly   327 DEMVEFDAAVETVIQMTDPRDTLVVVTADHSHTLSMSGYAKRGTPILGMDAQQRDVNGVPYSTLN 391
            .|:.|||.|::..:..|||.:||::|||||||.::.:|||.||..|||........:.:.|.|::
  Fly   387 HELYEFDLAIQAAVNNTDPDETLILVTADHSHAVTFNGYALRGADILGTANSHEKNDPMFYETIS 451

  Fly   392 YAIGK--WQSLDKDGRRESPSKTLSPTSY-------TPSYIH----GRKG-VHSGEDVVVFAMGP 442
            ||.|.  |..|..|.|.::.|....|..:       .|:|.|    .||. .|.||||.|||.||
  Fly   452 YANGPGYWDHLANDSRPQNSSNMWMPLKHFTAEERAAPTYRHLATVPRKDETHGGEDVAVFAYGP 516

  Fly   443 QSHLFGGVMEQNLLPHIMGYAACLGNGLTL---CNQDKD 478
            .|.|..||.|||.|.::|.||.|||.....   |...||
  Fly   517 GSSLIRGVFEQNYLAYVMSYAGCLGPAKDFDDSCEDHKD 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 183/457 (40%)
Alp4NP_524601.2 PhoA 60..534 CDD:224699 185/477 (39%)
alkPPc 85..541 CDD:214515 183/457 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455884
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.