DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp11 and SPBC14F5.13c

DIOPT Version :8

Sequence 1:NP_573047.1 Gene:Alp11 / 32496 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_596739.1 Gene:SPBC14F5.13c / 2539926 PomBaseID:SPBC14F5.13c Length:532 Species:Schizosaccharomyces pombe

Alignment Length:363 Identity:105/364 (29%)
Similarity:165/364 (45%) Gaps:54/364 (15%)


  Fly    12 FLLHALIPILALSVPMVEQVQPADELLSSHWLRQAQSQLRERLARTKDSIADVRQAKNVVMLLGD 76
            ::.|.::.||.||..:...      ..|||                 .|.....:.|.|:|::.|
pombe    27 WIKHGILLILVLSTVIFFY------FFSSH-----------------KSKGTNEKPKFVIMMVSD 68

  Fly    77 GLSITTLTAARIL---KGQRRGGRGEDAQLAVEQFPFSGLSKTYCIDEQTPDSACTATAYFGGVK 138
            |:...:|:..|..   ...:.|.|     |.:::. ..|.|:|........|||..|||:....|
pombe    69 GMGPGSLSMTRSFVETLNDKEGYR-----LPLDEH-LIGSSRTRSSSSLITDSAAGATAFSCANK 127

  Fly   139 THSGTVGQSGSGERVDSVLQWAQRAGKATGVVTTTRLTDASPAGAYAHVSRRGEELEIARQLVEE 203
            |::|.||...:.:...::|:.|:.||..||:|.|:|:|||:||...||.:.|..:..||...|..
pombe   128 TYNGAVGVLDNEKPCGTILEAAKEAGYLTGIVVTSRVTDATPASFSAHAANRFMQDLIAEYQVGM 192

  Fly   204 EP-GRNLNVILGGGLGKFADE------RRDGKDLLAQWRESNPNGCFSRSLKELRNCTD------ 255
            .| ||:::::.||||..|..:      |.|..|||...|:       ....:.|.|.||      
pombe   193 GPLGRSVDLLFGGGLCSFLPKSTYRSCRSDNLDLLKYARK-------KEGFQILLNRTDFDELSN 250

  Fly   256 ATGTLLGIFSDSHMSYHLAASKEL-PRLCDMAAAAIEKLERKSQED-GNGYFVFIEGGRIDHGHH 318
            |...|||:|||.|:||.:....|: |:|.:|...|::.|...:.|| ..|:|:.|||.|||...|
pombe   251 AQLPLLGLFSDYHLSYDIDYQPEVQPKLSEMVETALDVLLNATNEDTSKGFFLLIEGSRIDMASH 315

  Fly   319 ETRVGYALDEMVEFDAAVETVIQMTDPRDTLVVVTADH 356
            .......:.|::|::.|.|......:.....::.|:||
pombe   316 NNDPIAHVYEVMEYNRAFEIASAFVEKNGGSLISTSDH 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 96/308 (31%)
SPBC14F5.13cNP_596739.1 PhoA 3..495 CDD:224699 105/364 (29%)
ALP_like 60..487 CDD:304875 96/308 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1439
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T631406
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.