DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp11 and ALPI

DIOPT Version :8

Sequence 1:NP_573047.1 Gene:Alp11 / 32496 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001622.2 Gene:ALPI / 248 HGNCID:437 Length:528 Species:Homo sapiens

Alignment Length:499 Identity:191/500 (38%)
Similarity:265/500 (53%) Gaps:57/500 (11%)


  Fly    20 ILALSVPMVEQVQPADELLSSHWLRQAQSQLRERLARTKDSIADVRQAKNVVMLLGDGLSITTLT 84
            :|.|.:.:...|.||:|...:.|.|||...|  ..|:....|..|  |||:::.|||||.:.|:|
Human     9 LLGLRLQLSLGVIPAEEENPAFWNRQAAEAL--DAAKKLQPIQKV--AKNLILFLGDGLGVPTVT 69

  Fly    85 AARILKGQRRGGRGEDAQLAVEQFPFSGLSKTYCIDEQTPDSACTATAYFGGVKTHSGTVGQSGS 149
            |.||||||:.|..|.:..||:::||:..|||||.:|.|.||||.|||||..|||.:..|:|.|.:
Human    70 ATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAA 134

  Fly   150 ----------GERVDSVLQWAQRAGKATGVVTTTRLTDASPAGAYAHVSRRG------------E 192
                      |..|.||:..|::|||:.|||||||:..|||||.|||...|.            :
Human   135 ARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQ 199

  Fly   193 E--LEIARQLVEEEPGRNLNVILGGG------LGKFADE----------RRDGKDLLAQWRESNP 239
            |  .:||.||:.   ..:::||||||      :|....|          |.|||:|:.:|...:.
Human   200 EGCQDIATQLIS---NMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQ 261

  Fly   240 NGCFSRSLKELRNCT-DATGT-LLGIFSDSHMSYHLAASKEL-PRLCDMAAAAIEKLERKSQEDG 301
            ...:..:..||...: |.:.| |:|:|......|.:.....| |.|.:|..||:..|.|..:   
Human   262 GAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPR--- 323

  Fly   302 NGYFVFIEGGRIDHGHHETRVGYALDEMVEFDAAVETVIQMTDPRDTLVVVTADHSHTLSMSGYA 366
             |:::|:|||||||||||.....||.|.|.||.|:|...|:|...|||.:|||||||..|..||.
Human   324 -GFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYT 387

  Fly   367 KRGTPILGMDAQQRDVNGVPYSTLNYAIGKWQSLDKDGRRE-SPSKTLSPTSYTPSYIHGRKGVH 430
            .||:.|.|: |..:..:...|:::.|..|.....:...|.: :.|::.||.....:.:......|
Human   388 LRGSSIFGL-APSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETH 451

  Fly   431 SGEDVVVFAMGPQSHLFGGVMEQNLLPHIMGYAACLGNGLTLCN 474
            .||||.|||.|||:||..||.||:.:.|:|.:|||| ...|.|:
Human   452 GGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACL-EPYTACD 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 174/443 (39%)
ALPINP_001622.2 Alk_phosphatase 52..487 CDD:306706 174/443 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21922218
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.