DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alp11 and Alppl2

DIOPT Version :8

Sequence 1:NP_573047.1 Gene:Alp11 / 32496 FlyBaseID:FBgn0030661 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_031459.3 Gene:Alppl2 / 11650 MGIID:108009 Length:529 Species:Mus musculus

Alignment Length:503 Identity:186/504 (37%)
Similarity:274/504 (54%) Gaps:72/504 (14%)


  Fly    16 ALIPILALSVPMVEQVQPADELLSSHWLRQAQSQL--RERLARTKDSIADVRQAKNVVMLLGDGL 78
            |.:.:|.||:.:...|.|.:|...:.|.|:|...|  .::|...:.|      |||:|:|:|||:
Mouse     4 ACLLLLGLSLQVCPSVIPVEEENPAFWNRKAAEALDAAKKLKPIQTS------AKNLVILMGDGM 62

  Fly    79 SITTLTAARILKGQRRGGRGEDAQLAVEQFPFSGLSKTYCIDEQTPDSACTATAYFGGVKTHSGT 143
            .::|:||.||||||::|..|.:.|||:::||...|||||..|:|.||||.|.||:..||||:...
Mouse    63 GVSTVTATRILKGQQQGHLGPETQLAMDRFPHMALSKTYNTDKQIPDSAGTGTAFLCGVKTNMKV 127

  Fly   144 VGQSGS----------GERVDSVLQWAQRAGKATGVVTTTRLTDASPAGAYAHVSRRG------- 191
            :|.|.:          |..|.||:..|::|||:.||||||.:..|||||.|||...||       
Mouse   128 IGLSAAARFNQCNTTWGNEVVSVMHRAKKAGKSVGVVTTTSVQHASPAGTYAHTVNRGWYSDAQM 192

  Fly   192 --EEL-----EIARQLVEEEPGRNLNVILGGGLGKF-----------------ADERRDGKDLLA 232
              ..|     :|:.||:.   ..:::|||||| .||                 |..|.||::|:.
Mouse   193 PASALQDGCKDISTQLIS---NMDIDVILGGG-RKFMFPKGTPDQEYPTDTKQAGTRLDGRNLVQ 253

  Fly   233 QWRESNPNGCFSRSLKEL------RNCTDATGTLLGIFSDSHMSY--HLAASKELPRLCDMAAAA 289
            :|...:....:..:..||      |:.|.    |:|:|..:.|.|  |...::: |.|.:|...|
Mouse   254 EWLAKHQGARYVWNRSELIQASLNRSVTH----LMGLFEPNDMKYEIHRDPAQD-PSLAEMTEVA 313

  Fly   290 IEKLERKSQEDGNGYFVFIEGGRIDHGHHETRVGYALDEMVEFDAAVETVIQMTDPRDTLVVVTA 354
            :..|.|..:    |:::|:||||||||||||....||.|.|.||:||:...::|..:||:::|||
Mouse   314 VRMLSRNPK----GFYLFVEGGRIDHGHHETVAYRALTEAVMFDSAVDKADKLTSEQDTMILVTA 374

  Fly   355 DHSHTLSMSGYAKRGTPILGMDAQQRDVNGVPYSTLNYAIGKWQSLDKDGRRE-SPSKTLSPTSY 418
            ||||..|..||.:||..|.|: |..:..:|..::::.|..|....|....|.: :..::.:||..
Mouse   375 DHSHVFSFGGYTQRGASIFGL-APFKAEDGKSFTSILYGNGPGYKLHNGARADVTEEESSNPTYQ 438

  Fly   419 TPSYIHGRKGVHSGEDVVVFAMGPQSHLFGGVMEQNLLPHIMGYAACL 466
            ..:.:......||||||.:||.|||:||..||.|||.:.|:|.:||||
Mouse   439 QQAAVPLSSETHSGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAACL 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp11NP_573047.1 ALP_like 68..467 CDD:304875 172/450 (38%)
Alppl2NP_031459.3 PRK10518 16..473 CDD:236706 174/477 (36%)
Alk_phosphatase 51..486 CDD:278666 172/449 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21928344
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.