DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and MSR1

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_011959.1 Gene:MSR1 SGDID:S000001133 Length:643 Species:Saccharomyces cerevisiae

Alignment Length:560 Identity:100/561 (18%)
Similarity:175/561 (31%) Gaps:218/561 (39%)


  Fly    80 GDELLPSP-VDRLELMEHSRKWRFPLAEITVLNK---ERYSLRF---QRHPIIAHVLNSVLTLRG 137
            ||.|||.| :...:.:..:.:|...|:....:.|   :...|:|   ||: :|...:.::|..:|
Yeast   105 GDLLLPLPKIKVADPVAVANRWAIELSTHGCIGKVCAKGPFLQFFLDQRY-LIQSTVPNILLQKG 168

  Fly   138 DYGRSANNNQSRTIC-LQLQAVVGAVDGGQDLRHYRLQQLYKILLRLVDYSSWRLVEPN-----D 196
            .||:..:.:|.:.:. .....:......|    |.|...:...|..|.:...|.:...|     .
Yeast   169 KYGQKKSRHQKKVVVEFSSPNIAKPFHAG----HLRSTIIGGFLSNLYEAMGWSVTRMNYLGDWG 229

  Fly   197 RQKDTICVTVEL---EKCCNGKQPVEH-----VCLTCGPVLEPINKGAS---------------- 237
            ||...:.|..:.   ||... |||::|     |.:......|.||..:.                
Yeast   230 RQFGLLAVGFKRYGDEKTLQ-KQPIQHLFDVYVKINMDLAKEEINGNSKCGISGEARSFFKNLEN 293

  Fly   238 -------------SLTVDEYLKLRCQHMELMATQRSGMCPVPMSSL---------DTLTKRLAAA 280
                         ||::..|:: ....:.:.....||...|...|:         :.|.|.:..|
Yeast   294 GDENAIKIWNRFRSLSIHHYIQ-TYSRLNINFDIFSGESQVSKESMNEALDIFRKNNLVKEIDGA 357

  Fly   281 AVI-------------------VDLFVVRHSSAVSVVRNGVGICKGASYI-----LYNSARLEAL 321
            .||                   ..|::.|...|....:..:...|....|     ||.| :...:
Yeast   358 LVIDLTQWSKRLGRVVVQKSDGTTLYLTRDVGAAIERKKNLHFDKMVYVISSQQDLYMS-QFFMI 421

  Fly   322 LRKFNYE------------VNNCAYEK--LPLLDEI-------DLSVLEDD------VD------ 353
            |:|.|:|            |...:..|  :..||.|       .|.::|::      ||      
Yeast   422 LKKMNFEWAKDLQHINFGMVQGMSTRKGNVVFLDTILDEARDKALQIMENNKMKISQVDNPQRVA 486

  Fly   354 --------------------WELIYGYLLTF---------------------------------- 364
                                :|..:..:|:|                                  
Yeast   487 DLIGVSAIIIQDMKSKRINNYEFNWNRMLSFEGDTGPYLQYTHSRLRSLERTSSDFTTDMLIHAD 551

  Fly   365 ------PELMESIMDQLDQGHCGLHLLVHYVENLAAAFS--------RFYY---------HKKVL 406
                  |:|:|.:           .||..|.:.|..||.        .:.:         :||:.
Yeast   552 FSNLNEPQLVELV-----------RLLAQYPDVLRRAFETQEPATIVTYLFKVCHQVSSCYKKIW 605

  Fly   407 LQKR--DELMPILYARIYLIKAVRQVLNTALAVLGIEPVD 444
            :..:  |..:|    |:.:..|.||||:.|:::||:.|||
Yeast   606 VSGKPADIAIP----RLAVYSASRQVLHNAMSLLGLVPVD 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 45/252 (18%)
MSR1NP_011959.1 argS 69..643 CDD:273085 100/561 (18%)
Arg_tRNA_synt_N 73..150 CDD:281483 11/45 (24%)
ArgRS_core 180..449 CDD:185675 46/276 (17%)
Anticodon_Ia_Arg 487..643 CDD:153410 28/171 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.