DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and YDR341C

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_010628.3 Gene:YDR341C / 851942 SGDID:S000002749 Length:607 Species:Saccharomyces cerevisiae


Alignment Length:489 Identity:89/489 - (18%)
Similarity:159/489 - (32%) Gaps:160/489 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFEFFTKPEKPDESGGDVAAPLLLKKFGKLIRYNNDDLTEQGDLTLAAIPRYW--------QKYL 69
            ||:.:.:..|..|..|| :.||.....||...|..  ..|.||.....|   |        :||:
Yeast   220 LFDVYVRINKDIEEEGD-SIPLEQSTNGKAREYFK--RMEDGDEEALKI---WKRFREFSIEKYI 278

  Fly    70 KSQG-LKLRID---GDELL--PSPVDRLEL-----MEHSRKWRFPLAEITVLNKERYSLRFQRHP 123
            .:.. |.::.|   |:..:  .|.:..::|     :.|..|... |.::|..||:......|:..
Yeast   279 DTYARLNIKYDVYSGESQVSKESMLKAIDLFKEKGLTHEDKGAV-LIDLTKFNKKLGKAIVQKSD 342

  Fly   124 IIAHVLNSVLTLRGDYGRSANNNQSRTICLQLQAVVGAVDGGQDLRHYRLQQLYKILLRL----- 183
                  .:.|.|..|.|.:.:..:.    .....::..:...|||   ...|.::||.::     
Yeast   343 ------GTTLYLTRDVGAAMDRYEK----YHFDKMIYVIASQQDL---HAAQFFEILKQMGFEWA 394

  Fly   184 --VDYSSWRLVEPNDRQKDTICV-------TVE-----LEKCCNGKQPVEH-------VCLTCGP 227
              :.:.::.:|:....:|.|:..       |.|     ::|..|....:||       |.::...
Yeast   395 KDLQHVNFGMVQGMSTRKGTVVFLDNILEETKEKMHEVMKKNENKYAQIEHPEEVADLVGISAVM 459

  Fly   228 VLEPINKGAS----------SLTVDEYLKLRCQHMELMATQR--SGMCPVPMSSLDTLTKRLAAA 280
            :.:...|..:          |...|....|:..|..|.:.:|  ||:......:.|....:..||
Yeast   460 IQDMQGKRINNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAA 524

  Fly   281 AVIVDLFVVRHSSAVSVVRNGVGICKGASYILYNSARLEALLRKFNYEVNNCAYEKLPLLDEIDL 345
            .:::.|.    .....|:||.:...:..:.:.|        |.|..::|::|.            
Yeast   525 KLLIRLL----GQYPDVLRNAIKTHEPTTVVTY--------LFKLTHQVSSCY------------ 565

  Fly   346 SVLEDDVDWELIYGYLLTFPELMESIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQKR 410
                 ||.|                              :....|.||.                
Yeast   566 -----DVLW------------------------------VAGQTEELAT---------------- 579

  Fly   411 DELMPILYARIYLIKAVRQVLNTALAVLGIEPVD 444
                    ||:.|..|.||||...:.:||:.||:
Yeast   580 --------ARLALYGAARQVLYNGMRLLGLTPVE 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 23/134 (17%)
YDR341CNP_010628.3 argS 31..607 CDD:273085 89/489 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.