DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and Dalrd3

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_006511855.1 Gene:Dalrd3 MGIID:1915039 Length:545 Species:Mus musculus

Alignment Length:231 Identity:52/232 (22%)
Similarity:94/232 (41%) Gaps:34/232 (15%)


  Fly   203 CVTVELEKC---------------CNGKQPVEHVCLTCGPVLEPINKGASSLTVDEYLKLR-CQH 251
            ||.:.:..|               .:.:.|.:...|.|||| :......:.||..:|.:|| .|.
Mouse   275 CVVIHVVSCEEAFQQQKLDLLWQKLDDRAPHKQKHLVCGPV-KMAGVPGTQLTAPQYYRLRHAQV 338

  Fly   252 MELMATQRSG---MCPVPMSSLDTLTKRLAAAAVIVDLFVVRHSSAVSVVRNGVGI--CKGASYI 311
            .|..|.:..|   ..|....:.|.    |:.|.:..::......|.:.:..:.:..  .|..:::
Mouse   339 CEASALKHGGDLAQDPAWTETFDI----LSVATIKFEMLSTAPQSQLLLAHSTISTKGTKSGTFV 399

  Fly   312 LYNSARLEALLRKFNYEVNNCAYEKLPLLDEIDLSVLEDDVDWELIYGYLLTFPELMESIMDQLD 376
            :||.|||..|...:.:......|...||:..:|.|:|.|:.:|.|::..:|.|.:|:...:..  
Mouse   400 MYNCARLATLFEGYKHGTEQGLYPTFPLVSSLDFSLLHDEGEWLLLFNSVLPFLDLLSQTVSL-- 462

  Fly   377 QGHCGLHLLVH------YVENLAAAFSRFYYHKKVL 406
            .|..|||:.|.      ::..|:..||.:|....:|
Mouse   463 AGTPGLHIPVRTEMVCKFLVQLSMDFSSYYNRVHIL 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 28/103 (27%)
Dalrd3XP_006511855.1 DALR_1 399..>499 CDD:214846 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C297143965
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8236
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007632
OrthoInspector 1 1.000 T1085220
orthoMCL 1 0.900 OOG5_134407
Panther 1 1.100 LDO PTHR16043
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5723
TreeFam 1 0.960
109.680

Return to query results.
Submit another query.