DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and RARS

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_002878.2 Gene:RARS HGNCID:9870 Length:660 Species:Homo sapiens

Alignment Length:142 Identity:43/143 (30%)
Similarity:71/143 (50%) Gaps:21/143 (15%)


  Fly   308 ASYILYNSARLEALLRKFNYE---VNNCAYEKLPLLDEIDLSVLEDDVDWELIYG-YLLTFPELM 368
            |:|:||...|:.::.|..|.:   :...|.|...|||.        :.:|:|  | .:|.|||::
Human   531 AAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDH--------EKEWKL--GRCILRFPEIL 585

  Fly   369 ESIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQKRD--ELMPILYARIYLIKAVRQVL 431
            :.|:|.|     .||.|..|:..||.||:.||.....:.:.|.  :::.:...|:.|.:||..|:
Human   586 QKILDDL-----FLHTLCDYIYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEAVAAVM 645

  Fly   432 NTALAVLGIEPV 443
            .....:|||:||
Human   646 AKGFDILGIKPV 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 41/140 (29%)
RARSNP_002878.2 Could be involved in the assembly of the multisynthetase complex 1..72
tRNA-synt_1d 80..660 CDD:332079 43/143 (30%)
L-arginine binding. {ECO:0000244|PDB:4Q2T, ECO:0000269|PubMed:24859084} 200..202
'HIGH' region 201..212
Interaction with tRNA. {ECO:0000250|UniProtKB:Q05506} 529..543 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.