DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and RARS2

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001337434.1 Gene:RARS2 HGNCID:21406 Length:588 Species:Homo sapiens

Alignment Length:492 Identity:101/493 (20%)
Similarity:185/493 (38%) Gaps:155/493 (31%)


  Fly     1 MDCNPRLQVGQQLFEFFTKPEKPDESGGDVAAPLLLKKFGKLIRYNNDDLTEQGDLTLAAIPRYW 65
            :..||.    |.|||.:.:..|  |:..|.:.....::|.:.:        |.||:...::   |
Human   194 LQSNPL----QHLFEVYVQVNK--EAADDKSVAKAAQEFFQRL--------ELGDVQALSL---W 241

  Fly    66 QKYLKSQGLKLRIDGDELLPSPVDRLELMEHSRKWRFPLAEITVLNKERYSLRFQRHPI--IAHV 128
            ||:..                    |.:.|:.|.::    .:.|...|.....|.|...  :..:
Human   242 QKFRD--------------------LSIEEYIRVYK----RLGVYFDEYSGESFYREKSQEVLKL 282

  Fly   129 LNS----VLTLRGD--YGRSANNNQSRTICLQLQA-------------------------VVGAV 162
            |.|    :.|::|.  ...|.|.:.| :||..:::                         ::...
Human   283 LESKGLLLKTIKGTAVVDLSGNGDPS-SICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVT 346

  Fly   163 DGGQDLRHYRLQQLYKILLRLVDYSSWRLVEPNDRQKDTICVTVELEKCCNGKQPVEHVCLTCGP 227
            |.||. :|:  ||::: :|:::.| .|                  .|:|       :||     |
Human   347 DKGQK-KHF--QQVFQ-MLKIMGY-DW------------------AERC-------QHV-----P 376

  Fly   228 --VLEPINKGASSLT----VDEYLKLR-CQHMELMATQRSGMCPVPMSSLDTLTKRLAAAAVIVD 285
              |::.:......:|    |...::|| .|:|..:.|.:.      :.:.....:|:..||:|:.
Human   377 FGVVQGMKTRRGDVTFLEDVLNEIQLRMLQNMASIKTTKE------LKNPQETAERVGLAALIIQ 435

  Fly   286 LFV------VRHS-SAVSVVRNGVGICKGASYILYNSARLEALLRKFNYEVNNCAYEKLPLLDEI 343
            .|.      .:.| ..|...|...|:     ::.|..|||.:|...|     .|.|     |::.
Human   436 DFKGLLLSDYKFSWDRVFQSRGDTGV-----FLQYTHARLHSLEETF-----GCGY-----LNDF 485

  Fly   344 DLSVLEDDVDWELIYGYLLTFPELMESIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQ 408
            :.:.|::.....::. :||.|.|::..........|...:||.  :.:|||.     .||  .||
Human   486 NTACLQEPQSVSILQ-HLLRFDEVLYKSSQDFQPRHIVSYLLT--LSHLAAV-----AHK--TLQ 540

  Fly   409 KRDELMPILYARIYLIKAVRQVLNTALAVLGIEPVDY 445
            .:|....:..||::|.||||.||...:.:|||.|:::
Human   541 IKDSPPEVAGARLHLFKAVRSVLANGMKLLGITPMEF 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 38/134 (28%)
RARS2NP_001337434.1 tRNA-synt_1d 36..576 CDD:332079 101/490 (21%)
'HIGH' region 133..144
L-arginine binding. {ECO:0000250|UniProtKB:P54136} 133..135
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.