DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and rars

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_989403.1 Gene:rars XenbaseID:XB-GENE-955966 Length:660 Species:Xenopus tropicalis

Alignment Length:141 Identity:41/142 (29%)
Similarity:72/142 (51%) Gaps:19/142 (13%)


  Fly   308 ASYILYNSARLEALLRKFNY---EVNNCAYEKLPLLDEIDLSVLEDDVDWELIYGYLLTFPELME 369
            |:|:||...|:.::.|..|.   :::..|.|     .||   :||.:.:|:| ...:|.|||:::
 Frog   531 AAYLLYAYTRIRSIARLANISDEDLHKAAKE-----TEI---ILEHEKEWKL-SKCILRFPEILQ 586

  Fly   370 SIMDQLDQGHCGLHLLVHYVENLAAAFSRFYYHKKVLLQKRD--ELMPILYARIYLIKAVRQVLN 432
            .|:|.|     .||.|..|:..||..|:.||.:...:.:.|.  :::.:..:|:.|..|...|:.
 Frog   587 KILDDL-----LLHTLCDYLYELATTFTEFYDNCYCVEKDRQTGQIVKVNMSRLLLCDATAAVMA 646

  Fly   433 TALAVLGIEPV 443
            ....:|||:||
 Frog   647 KGFDILGIKPV 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 39/139 (28%)
rarsNP_989403.1 Could be involved in the assembly of the multisynthetase complex. {ECO:0000250} 1..72
Syntaphilin <9..>79 CDD:291936
PLN02286 79..660 CDD:215160 41/142 (29%)
Arg_tRNA_synt_N 79..166 CDD:214975
ArgRS_core 193..457 CDD:185675
L-arginine binding. {ECO:0000250|UniProtKB:P54136} 200..202
'HIGH' region 201..212
Anticodon_Ia_like 498..660 CDD:299868 41/142 (29%)
Interaction with tRNA. {ECO:0000250|UniProtKB:Q05506} 529..543 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.