DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and ArgRS

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_573081.1 Gene:ArgRS FlyBaseID:FBgn0027093 Length:665 Species:Drosophila melanogaster

Alignment Length:485 Identity:99/486 (20%)
Similarity:165/486 (34%) Gaps:149/486 (31%)


  Fly    38 KFGKLIRYNNDDLTEQGDLTLAAIPRY---------WQKYLKSQGLKLRIDGDEL---------- 83
            :||.||.:..|           ..|.|         .|.:.|..  |.|.|.||.          
  Fly   248 QFGMLIAHLED-----------RFPNYLNESPPISDLQLFYKES--KKRFDEDEEFKKRAYSRVV 299

  Fly    84 -----LPSPVDRLELM-EHSRK-WRFPLAEITVLNKERYSLRFQRHPIIAHVLNSVLTLRG---- 137
                 :|:.:...||: ..||| ::.....:.:..|||....:|     :.:|:.|..|||    
  Fly   300 SLQKGVPNSIKAWELICNVSRKEFQTIYERLDISVKERGESFYQ-----SRMLSVVEYLRGKGLL 359

  Fly   138 --DYGRSANNNQSRTICLQLQAVVGAVDGG--------QDLRHYRLQQLYKILLRLVDYSSWRLV 192
              |.||...........:.|..|..  |||        ..:||...::|...::.:||       
  Fly   360 EVDEGREIMWPDDTKTGIPLTIVKS--DGGFTYDTSDMAAIRHRLEEELCDWIIYVVD------- 415

  Fly   193 EPNDRQKDTICVTVELEKCCNG-KQPVEHVCLTCGPVLEPINKGASSLT---------VDEYLKL 247
            .......:||....|.....|. ...|:||  ..|.||....|...:.:         :||.:|.
  Fly   416 SGQSTHFNTIFKAAERSAILNPLSHRVDHV--QFGVVLGEDGKKFKTRSGDTVKLSDLLDEGMKR 478

  Fly   248 RCQHMELMATQR---------------------SGMCPVPMS----SLDTLTKRLAAAAVIVDLF 287
            ..|.:|.....:                     |.:|...:|    |.|.:.:.....||     
  Fly   479 SLQQLESRGRDKVLTPQELKDAQESLAYGCIKYSDLCHNRISDYIFSFDKMLEDRGNTAV----- 538

  Fly   288 VVRHSSAVSVVRNGVGICKGASYILYNSARLEALLRKFNYEVNNCAYEKLP-LLDEIDLSVLEDD 351
                                  |:||...|:.::.|....:..|     || :|.:.:: ||:.:
  Fly   539 ----------------------YLLYTYTRICSIARNSGEDFTN-----LPEILKKTNI-VLDHE 575

  Fly   352 VDWELIYGYLLTFPELMESIMDQLDQGHCGLHLLVHYVENLAAAFSRFY---YHKKVLLQKRDEL 413
            .:|:|. ..||...:::.....:|     .||.|..:...:...|:.||   |  .:...|:.::
  Fly   576 KEWKLA-KTLLKLHDILIKCSKEL-----FLHFLCEFCFEVCTVFTEFYDSCY--CIEKNKQGDI 632

  Fly   414 MPILYARIYLIKAVRQVLNTALAVLGIEPV 443
            :.:.::||.|.:|...||.....:||::||
  Fly   633 IGVNHSRILLCEATAAVLRQCFYILGLKPV 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 33/138 (24%)
ArgRSNP_573081.1 Arg_tRNA_synt_N 81..171 CDD:214975
PLN02286 83..665 CDD:215160 99/486 (20%)
ArgRS_core 197..463 CDD:185675 53/244 (22%)
DALR_1 540..665 CDD:214846 33/138 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.