DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8097 and rars-2

DIOPT Version :9

Sequence 1:NP_001285279.1 Gene:CG8097 / 32495 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_495227.1 Gene:rars-2 / 174023 WormBaseID:WBGene00004680 Length:512 Species:Caenorhabditis elegans


Alignment Length:285 Identity:52/285 - (18%)
Similarity:103/285 - (36%) Gaps:82/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EKPDESG--------GDVAAPLLLKKFGKLIRYNNDDLTEQGDLTLAAIPRYWQKYLKSQGLKLR 77
            ||....|        .|:::..|.::...::   :.|...|.|..|..:.|..:::.|:..:.|.
 Worm   229 EKKQSDGVNYAVLRKSDMSSLYLTREIAAIL---DRDAMFQADRYLYVVDRAQRQHFKALKVILE 290

  Fly    78 IDGDELLPSPVDRL-------------------ELMEHSRKWRFPLAEITVLNKERYSLRFQRHP 123
            ..|...|.|.::.:                   |::|..|:        ..|...:.|..|...|
 Worm   291 KIGRSDLASKIEHIQYGRVRGLSTRNGRTEAVGEIIEKGRE--------LALQFMKSSKTFCMDP 347

  Fly   124 IIAHVLNSVLTL------------RGDYGRSANN----NQSRTICLQLQAVVGAVDGGQDLRHYR 172
            .:...:.:||:|            ..:|..|..|    ||:..:.||             ::|.|
 Worm   348 AVESDIANVLSLSTVVFNELKRARNSEYEFSFQNAFALNQNNALALQ-------------MKHSR 399

  Fly   173 L-------QQLYKILLRLVDYSSWRLVEPNDRQKDTICVTVELEKCCN-GKQPVEHVCLTCGPVL 229
            |       |.|:..:.....::.:   :.||..|..|.:..:|||... ..:.:|    .|...:
 Worm   400 LSSIEEKHQHLFPQIEACTKFNDF---DTNDDVKRLIRLLNDLEKAVELSAEKLE----ACQLTV 457

  Fly   230 EPINKGASSLTVDEYLKLRCQHMEL 254
            :.|:..|::.:|.:.|:::.|..|:
 Worm   458 QLIHVAAAAGSVQKQLRVKDQPDEV 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846
rars-2NP_495227.1 ArgS 28..512 CDD:223097 52/285 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.