DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and Rars

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_080212.2 Gene:Rars MGIID:1914297 Length:660 Species:Mus musculus

Alignment Length:519 Identity:107/520 (21%)
Similarity:185/520 (36%) Gaps:171/520 (33%)


  Fly    12 QLFEFFTKPEKPDESGGDVAAPLLLK-------KFGKLIRYNNDDLTEQ-------GDLTLAAIP 62
            :||||         :|.||   |.|.       :||.||.:..|...:.       |||      
Mouse   223 RLFEF---------AGYDV---LRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDL------ 269

  Fly    63 RYWQKYLKSQGLKLRIDGDELLPSPVDRLELMEHSRK------WR-------------FPLAEIT 108
               |.:.|..  |.|.|.||.......:..::..|:.      |.             :...:||
Mouse   270 ---QAFYKES--KKRFDADEEFKKRAYQCVVLLQSKNPDIMKAWNLICDVSREEFKKIYDALDIT 329

  Fly   109 VLNKER--YSLRFQ-----------------RHPIIAHVLNSVLTL-RGDYGRSANNNQSRTICL 153
            ::.:..  |..|.:                 |..:.....:..||: :.|.|.:.:.:....|..
Mouse   330 LIERGESFYQDRMKDIVKEFEDKGFVQVDDGRKIVFVPGCSVPLTIVKSDGGYTYDTSDLAAIKQ 394

  Fly   154 QL-----QAVVGAVDGGQDLRHYR-----LQQL--YKILLRLVDYSSWRLVEPNDRQK------D 200
            :|     ..::..||.||.: |::     .|.:  |...:.||.:..:.:|...|::|      :
Mouse   395 RLFEEKANKIIYVVDNGQAI-HFQTIFAAAQMIGWYDPKVTLVTHVGFGVVLGEDKKKFKTRSGE 458

  Fly   201 TICVTVELEKCCNGKQPVEHVCLTCGPVLEPINKGASSLTVDEYLKLRCQHMELMATQRS---GM 262
            |:.:...||                    |.:.:....|...|..|:..:. ||.|.|.|   |.
Mouse   459 TVRLMDLLE--------------------EGLKRSMDKLKEKERDKVLTEE-ELKAAQTSVAYGC 502

  Fly   263 CPVPMSSLDTLTKRLAAAAVIVDLFVVRHSSAVSVVRNGVGICKG--ASYILYNSARLEALLRKF 325
            ......|.:.|...:.:...::|                   .:|  |:|:||...|:.::.|..
Mouse   503 IKYADLSHNRLNDYIFSFDKMLD-------------------DRGNTAAYLLYAFTRIRSIARLA 548

  Fly   326 NYEVNNCAYEKLPLLDEIDLS--------VLEDDVDWELIYG-YLLTFPELMESIMDQLDQGHCG 381
            |             :||..|.        :|:.:.:|:|  | .:|.|||:::.|:|.|     .
Mouse   549 N-------------IDEAMLQRAARETKIILDHEKEWKL--GRCILRFPEILQKILDDL-----F 593

  Fly   382 LHLLVHYVENLAAAFSRFYYHKKVLLQKRD--ELMPILYARIYLIKAVRQVLNTALAVLGIEPV 443
            ||.|..|:..||..|:.||.....:.:.|.  :::.:...|:.|.:||..|:.....:|||:||
Mouse   594 LHTLCDYIYELATTFTEFYDSCYCVEKDRQTGKVLKVNMWRMLLCEAVAAVMAKGFDILGIKPV 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 39/145 (27%)
RarsNP_080212.2 Could be involved in the assembly of the multisynthetase complex 1..72
Arg_tRNA_synt_N 79..166 CDD:214975
PLN02286 80..660 CDD:215160 107/520 (21%)
ArgRS_core 193..457 CDD:185675 49/258 (19%)
L-arginine binding. {ECO:0000250|UniProtKB:P54136} 200..202
'HIGH' region 201..212
Anticodon_Ia_like 498..660 CDD:299868 46/200 (23%)
Interaction with tRNA. {ECO:0000250|UniProtKB:Q05506} 529..543 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.