DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8097 and rars2

Sequence 1:NP_001285279.1 Gene:CG8097 FlyBaseID:FBgn0030660 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_002933968.2 Gene:rars2 XenbaseID:XB-GENE-976890 Length:576 Species:Xenopus tropicalis

Alignment Length:453 Identity:89/454 (20%)
Similarity:164/454 (36%) Gaps:168/454 (37%)


  Fly    15 EFFTKPEKPD-----ESGGDVAAPLLLKKFGK---LIRYNNDDLTEQGDLTLAAIPRYWQKYLKS 71
            |.|.|.:..:     ||.|      ||:|..|   ::     ||:|:|:|:      .:...::|
 Frog   267 ESFYKEKSQEVLKQLESNG------LLQKTDKGTGVV-----DLSEEGNLS------SYSTVMRS 314

  Fly    72 QGLKLRIDGDELLPSPVDRLE---------LMEHSRKWRFP--LAEITVLNKERYSLRFQRHPII 125
            .|..|.|..|  :.:.:||||         :.:.|:|..|.  ...:.:|.|::.. |||..|. 
 Frog   315 DGTSLYITRD--VAAALDRLERYSFDEMIYVTDKSQKNHFQQLFKILKILGKDQAD-RFQHVPF- 375

  Fly   126 AHVLNSVLTLRGDYGRSANNNQSRTICLQLQAVVGAVDGGQDLRHYRLQQLYKILLRLVDYSSWR 190
             .::..:.|.||:                   ||...|...:.|...||.:      ....:|.:
 Frog   376 -GLVKGMKTRRGE-------------------VVFLEDVLDEARSRMLQNM------AASGTSKQ 414

  Fly   191 LVEPNDRQKDTICVTVELEKCCNGKQPVEHVCLTCGPVLEPINKGASSLTVDEY--LKLRCQHME 253
            |.:|:|        |.|                         ..|.::|.|.::  ..|...|.:
 Frog   415 LEDPSD--------TAE-------------------------KIGIAALIVQDFKGQLLSDYHFD 446

  Fly   254 L-MATQRSGMCPVPMSSLDTLTKRLAAAAVIVDLFVVRHSSAVSVVRNGVGICKGASYILYNSAR 317
            . .|.|.:|         ||                            ||       ::.|..||
 Frog   447 WDQALQSTG---------DT----------------------------GV-------FLQYTHAR 467

  Fly   318 LEALLRKFNYEVNNCAYEKLPLLDEIDLSVLEDDVDWELIYGYLLTFPELMESIMDQLDQGHCGL 382
            |.:|...:      |:.:    .|:||::.|.:......:. :||.:.|::...::.|...:...
 Frog   468 LHSLQALW------CSRD----TDDIDIASLREPCVIATLQ-HLLRYDEVIYKCLEDLQPRYLVT 521

  Fly   383 HLL-VHYVENLAAAFSRFYYHKKVLLQKRDELMPILYARIYLIKAVRQVLNTALAVLGIEPVD 444
            :|: :.::.|:|        |:.:.:::...  ...:||::....||.||::.:.:|||.||:
 Frog   522 YLMSLGHLANVA--------HRALHVKRSSS--EAAHARLFFFNNVRMVLSSGMKLLGISPVN 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8097NP_001285279.1 DALR_1 311..445 CDD:214846 29/136 (21%)
rars2XP_002933968.2 ArgS 58..576 CDD:223097 89/454 (20%)
ArgRS_core 124..386 CDD:185675 35/141 (25%)
Anticodon_Ia_like 423..576 CDD:299868 42/243 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.