DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and Nsmce2

DIOPT Version :9

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001361697.1 Gene:Nsmce2 / 68501 MGIID:1915751 Length:273 Species:Mus musculus


Alignment Length:277 Identity:59/277 - (21%)
Similarity:103/277 - (37%) Gaps:84/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKAM------ 65
            ::|||::|...|.......:.||..:            :||.|....:.|::. :.|||      
Mouse    20 IESALSSLKNFQSCISSGMDTVSSVA------------LDLVETQTEVSSEYS-MDKAMVEFAKM 71

  Fly    66 -----KHAKNSSNTIEKFEEVWKERSEAVEQKRIDV---------KNS-AEFKNFMKAAA----- 110
                 .:.|...:||...:|   ||.|.|...::.|         ||| |:||...|...     
Mouse    72 DRELSHYVKAVQSTINHVKE---ERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQL 133

  Fly   111 --------------------PQAGAETNGQANSAAH-----------DEDLIMEATGGEVFSLYD 144
                                |...:...|......|           |||:|:..:......   
Mouse   134 RELKKQLVKPKEDGRHSEFDPNKDSSRAGNKRDGIHADRENDLTEGVDEDMIVTQSQTNFIC--- 195

  Fly   145 PWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIR----CPVLGCPNRSYIHPAHLVKDSNLQQ 205
            |.::..:|.||:||.|||.|:.::::.:|......:    ||.:|| :.:.:..:.|:.|..|::
Mouse   196 PITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGC-SHTDMRMSDLIPDEALRR 259

  Fly   206 KLQERMSDAIEKETSSE 222
            .::   |...:|:..||
Mouse   260 AIE---SHNKKKKRHSE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 16/61 (26%)
Nsmce2NP_001361697.1 SPL-RING_NSE2 193..262 CDD:319565 18/72 (25%)
SPL-RING finger 195..241 CDD:319565 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12442
eggNOG 1 0.900 - - E1_KOG2979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5448
Isobase 1 0.950 - 0 Normalized mean entropy S7995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21330
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5680
SonicParanoid 1 1.000 - - X2979
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.900

Return to query results.
Submit another query.