DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cerv and Nsmce2

DIOPT Version :8

Sequence 1:NP_001285278.1 Gene:cerv / 32492 FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_006521379.1 Gene:Nsmce2 / 68501 MGIID:1915751 Length:273 Species:Mus musculus

Alignment Length:277 Identity:59/278 (21%)
Similarity:103/278 (37%) Gaps:84/278 (30%)


  Fly     7 VDSALTTLLENQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKAM------ 65
            ::|||::|...|.......:.||..:            :||.|....:.|::. :.|||      
Mouse    20 IESALSSLKNFQSCISSGMDTVSSVA------------LDLVETQTEVSSEYS-MDKAMVEFAKM 71

  Fly    66 -----KHAKNSSNTIEKFEEVWKERSEAVEQKRIDV---------KNS-AEFKNFMKAAA----- 110
                 .:.|...:||...:|   ||.|.|...::.|         ||| |:||...|...     
Mouse    72 DRELSHYVKAVQSTINHVKE---ERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQL 133

  Fly   111 --------------------PQAGAETNGQANSAAH-----------DEDLIMEATGGEVFSLYD 144
                                |...:...|......|           |||:|:..:......   
Mouse   134 RELKKQLVKPKEDGRHSEFDPNKDSSRAGNKRDGIHADRENDLTEGVDEDMIVTQSQTNFIC--- 195

  Fly   145 PWSKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIR----CPVLGCPNRSYIHPAHLVKDSNLQQ 205
            |.::..:|.||:||.|||.|:.::::.:|......:    ||.:|| :.:.:..:.|:.|..|::
Mouse   196 PITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGC-SHTDMRMSDLIPDEALRR 259

  Fly   206 KLQERMSDAIEKETSSE 222
            .::   |...:|:..||
Mouse   260 AIE---SHNKKKKRHSE 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cervNP_001285278.1 RING 128..186 CDD:302633 17/62 (27%)
Nsmce2XP_006521379.1 zf-Nse 182..242 CDD:288622 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5405
Isobase 1 0.950 0 Normalized mean entropy S7995
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
OrthoInspector 1 1.000 T616931
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21330
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5680
TreeFam 1 0.960
98.900

Return to query results.
Submit another query.