DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and HPY2

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_188133.2 Gene:HPY2 AraportID:AT3G15150 Length:249 Species:Arabidopsis thaliana

Alignment Length:199 Identity:49/200 (25%)
Similarity:81/200 (41%) Gaps:43/200 (22%)


  Fly    12 LFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLEDT-NYMNAVES 75
            |...:||::...||      ..:.|..|:.    ...|.:.|||: .|....|:|. ..:.|..|
plant    58 LENSVAELLDLHSD------CNHRSTAIQS----VANRYQPVEQL-TDFKKLLDDEFTKLKATPS 111

  Fly    76 -------------EAQKNI--AGL------DEDLIMEDFGVEVVPFHDPWSKLLIKH---PVRNK 116
                         ||..|:  ||.      |||::|......::....|.|...:..   |||:.
plant   112 SVPQNDHLMRQFREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSM 176

  Fly   117 RCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEH--LVKDPDVEQELQKRKS-DKIKNETS 178
            .|.|:|::..:|..|.:|....|||..|..    ||::  ::.|..::.|:::.:| :|..|...
plant   177 DCRHVYEKSVILHYIVNNPNANCPVAGCRG----KLQNSKVICDAMLKFEIEEMRSLNKQSNRAE 237

  Fly   179 SDED 182
            ..||
plant   238 VIED 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 17/61 (28%)
HPY2NP_188133.2 RING 143..204 CDD:302633 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2555
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21330
Phylome 1 0.910 0.857 Consistency score
33.060

Return to query results.
Submit another query.