DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and CG42300

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_727865.2 Gene:CG42300 FlyBaseID:FBgn0259196 Length:181 Species:Drosophila melanogaster

Alignment Length:182 Identity:179/183 (98%)
Similarity:181/183 (99%) Gaps:1/183 (1%)


  Fly     1 MIKMDPKSHQKLFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLE 65
            |||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MIKMDPKSHQKLFKEMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLE 65

  Fly    66 DTNYMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMI 130
            ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 DTN-MNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMI 129

  Fly   131 IKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIKNETSSDED 182
            |||||||||||||||||||||||||||||||||||||||||||:||||||||
  Fly   130 IKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIQNETSSDED 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 58/58 (100%)
CG42300NP_727865.2 RING 85..143 CDD:302633 58/58 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141752921
eggNOG 1 0.900 E1_KOG2979
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21330
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.