DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and Nsmce2

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006521379.1 Gene:Nsmce2 MGIID:1915751 Length:273 Species:Mus musculus

Alignment Length:162 Identity:40/163 (25%)
Similarity:75/163 (46%) Gaps:23/163 (14%)


  Fly    30 LLTKNSSNTIEKSE----------EVCKERPEAVEQMR---IDVN-NSLEDTNYMNAVESEAQKN 80
            |..|||....:::|          |:.|:..:..|..|   .|.| :|....|..:.:.::.:.:
Mouse   111 LQDKNSDADFKENEKFVQFKQQLRELKKQLVKPKEDGRHSEFDPNKDSSRAGNKRDGIHADREND 175

  Fly    81 IA-GLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMII----KDNIGILCP 140
            :. |:|||:|:..   ....|..|.::|.:|.||:||.|||.|:.|.::.:|    |......||
Mouse   176 LTEGVDEDMIVTQ---SQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCP 237

  Fly   141 VRDCPNLSDIKLEHLVKDPDVEQELQKRKSDK 172
            ...|.: :|:::..|:.|..:.:.::.....|
Mouse   238 KIGCSH-TDMRMSDLIPDEALRRAIESHNKKK 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 20/62 (32%)
Nsmce2XP_006521379.1 zf-Nse 182..242 CDD:288622 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5405
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
OrthoInspector 1 1.000 T616931
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21330
Phylome 1 0.910 0.923 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.