DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and nsmce2

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001122190.1 Gene:nsmce2 ZFINID:ZDB-GENE-081022-128 Length:230 Species:Danio rerio

Alignment Length:172 Identity:45/173 (26%)
Similarity:71/173 (41%) Gaps:50/173 (29%)


  Fly    13 FREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSLEDTNYMNAVESEA 77
            |.|:...||:|.       .:|.|..:...|.|.|...:|                 .|..|:|.
Zfish    96 FTELIAGVSDSD-------LRNHSKVVAFKETVRKYAMQA-----------------QNPAENEE 136

  Fly    78 QKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMII----KDNIGIL 138
            ::    ||||:.:..   ....|..|.:::.:.:|::||:|.|.||:|.||.:|    |:.....
Zfish   137 EE----LDEDIAVTQ---SQTNFICPLTQVEMVNPMKNKKCNHYYDQEAVLEMIKNKHKNRKKFR 194

  Fly   139 CPVRDCPNLSDIKLEHLVKDPDVEQEL--------QKRKSDK 172
            ||...|.|..       |::.|:|.:|        |||:|.|
Zfish   195 CPKVGCGNAD-------VQESDLELDLIMKRMIQNQKRQSGK 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 18/62 (29%)
nsmce2NP_001122190.1 RING 143..201 CDD:302633 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141756000
eggNOG 1 0.900 E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5379
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21330
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.