DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and qjt

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001261988.1 Gene:qjt FlyBaseID:FBgn0036730 Length:233 Species:Drosophila melanogaster

Alignment Length:215 Identity:100/216 (46%)
Similarity:130/216 (60%) Gaps:41/216 (19%)


  Fly     9 HQKLFREMAEVVSNSSDDG--EKLL------------------------------TKNSSNTIEK 41
            ::|.|:||::.||:.||.|  :|||                              .||||.|||:
  Fly    17 NKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVEHAVNVVHMKIKHQSLNKAMNQVKNSSATIEE 81

  Fly    42 SEEVCKERPEAVEQMRIDVNNSLEDTNYMNAVESEA---------QKNIAGLDEDLIMEDFGVEV 97
            .|||.|||.:||||.||:|.|..|..|::.||||.|         |.|....||||||||.|.||
  Fly    82 FEEVWKERSKAVEQKRINVKNLHEFKNFVKAVESAAGQAGAEVNDQANGTAYDEDLIMEDSGSEV 146

  Fly    98 VPFHDPWSKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVE 162
            ..|:|||||.|||:|:|||.|||||||::|:.||.|.|||.|||..|.||..|:.:|||:|.:|:
  Fly   147 FSFYDPWSKALIKNPMRNKMCGHIYDRDSVMPIIMDRIGIRCPVLGCANLCYIQPDHLVQDANVQ 211

  Fly   163 QELQKRKSDKIKNETSSDED 182
            |::|:..|:.|.:.|:|:||
  Fly   212 QKIQQSMSNAIVDVTASEED 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 40/58 (69%)
qjtNP_001261988.1 RING 135..194 CDD:302633 41/59 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2979
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2555
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21330
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.