DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and cerv

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001285278.1 Gene:cerv FlyBaseID:FBgn0030657 Length:230 Species:Drosophila melanogaster

Alignment Length:208 Identity:114/209 (55%)
Similarity:133/209 (64%) Gaps:34/209 (16%)


  Fly     9 HQKLFREMAEVVSNSSDDGE--KLL--------------------------TKNSSNTIEKSEEV 45
            :||.|:|||||||:.||..|  |||                          .|||||||||.|||
  Fly    17 NQKFFKEMAEVVSDFSDGREIQKLLDQNVDLAENLIRMKSKHQLLSKAMKHAKNSSNTIEKFEEV 81

  Fly    46 CKERPEAVEQMRIDVNNSLEDTNYMNA------VESEAQKNIAGLDEDLIMEDFGVEVVPFHDPW 104
            .|||.|||||.||||.||.|..|:|.|      .|:..|.|.|..|||||||..|.||...:|||
  Fly    82 WKERSEAVEQKRIDVKNSAEFKNFMKAAAPQAGAETNGQANSAAHDEDLIMEATGGEVFSLYDPW 146

  Fly   105 SKLLIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRK 169
            ||.|||:|||||:|||||||::|::||.|||||.|||..|||.|.|...|||||.:::|:||:|.
  Fly   147 SKALIKNPVRNKKCGHIYDRDSVMLIITDNIGIRCPVLGCPNRSYIHPAHLVKDSNLQQKLQERM 211

  Fly   170 SDKIKNETSSDED 182
            ||.|:.||||:||
  Fly   212 SDAIEKETSSEED 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 40/58 (69%)
cervNP_001285278.1 RING 128..186 CDD:302633 40/58 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2979
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2555
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21330
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.