DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and NSMCE2

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_016868819.1 Gene:NSMCE2 HGNCID:26513 Length:249 Species:Homo sapiens

Alignment Length:198 Identity:45/199 (23%)
Similarity:76/199 (38%) Gaps:50/199 (25%)


  Fly    17 AEVVSNSSDDGEKL-----------LTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNSL------ 64
            |||.|..|.|...:           ..|...:||...:|   ||||.:..:::.|....      
Human    55 AEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKE---ERPEKIPDLKLLVEKKFLALQSK 116

  Fly    65 -EDTNYMN--------------------AVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLL 108
             .|.::.|                    ..:.||. ...|:|||:|:..   ....|..|.:|..
Human   117 NSDADFQNNEKFVQFKQQLKELKKQCGLQADREAD-GTEGVDEDIIVTQ---SQTNFTCPITKEE 177

  Fly   109 IKHPVRNKRCGHIYDRETVLMII----KDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRK 169
            :|.||:||.|||.|:.:.::.:|    |......||...|.: :||:...|::|..:.:.::...
Human   178 MKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSH-TDIRKSDLIQDEALRRAIENHN 241

  Fly   170 SDK 172
            ..:
Human   242 KKR 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 19/62 (31%)
NSMCE2XP_016868819.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5278
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
OrthoInspector 1 1.000 T610126
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21330
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.