DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and ZK1248.11

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_495157.1 Gene:ZK1248.11 WormBaseID:WBGene00022881 Length:201 Species:Caenorhabditis elegans

Alignment Length:192 Identity:44/193 (23%)
Similarity:80/193 (41%) Gaps:35/193 (18%)


  Fly    10 QKLFREMAE---------VVSNSSDDGE--KLLTKNSSNTIEKSEEVCKERPEAVEQMRIDVNNS 63
            :|..|:.||         .:||..|..|  :.|.|::...:|...|.. :.....|.:..|:.:.
 Worm    13 RKSLRKAAEDVLHINSKNAISNEVDSEEFKETLMKDAMKLMELETEGA-QMQHIFEALHNDLKDG 76

  Fly    64 LEDTNYMNAVE------SEAQKNIAG---LDEDLIM--------EDFGVEVVPFH----DPWSKL 107
            .::.....|:|      .:..||:.|   ..:|:|.        ::..:||:...    ||.||.
 Worm    77 SDEVPNEKALEELYEKAKKTHKNVKGERQYFKDIIKSIRDESKNDENEMEVMQVQHSRKDPISKK 141

  Fly   108 LIKHPVRNKRCGHIYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRK 169
            .|.:||.:|.|||:|||:::.........|.|.::.|.  ..|.:..|...||....:::::
 Worm   142 DIVNPVISKNCGHVYDRDSIHEFAGKKRVIKCAMQGCS--ETINIGQLADYPDYWTNIKQQQ 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 20/70 (29%)
ZK1248.11NP_495157.1 RING 124..179 CDD:302633 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141752954
eggNOG 1 0.900 E1_KOG2979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4048
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21330
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.