DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42299 and nsmce2

Sequence 1:NP_727866.2 Gene:CG42299 FlyBaseID:FBgn0259195 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_002938708.2 Gene:nsmce2 XenbaseID:XB-GENE-13579717 Length:169 Species:Xenopus tropicalis

Alignment Length:169 Identity:34/170 (20%)
Similarity:57/170 (34%) Gaps:54/170 (32%)


  Fly    17 AEVVSNSSDDGEKLLTKN------------SSNTIEKSEEVCKE-RPEAVEQMRIDVNNSLEDTN 68
            |.::|.||.|......|:            :|..::..|..|:. ..:|:|...::......|.|
 Frog     6 APMISFSSVDNSLSSLKSCQGYLSTGMDITASVALDLLETGCESTEVDALESAMLEYAEMERDLN 70

  Fly    69 -YMNAVESEAQK---------------------NIAG--LDEDLIMEDFGVEVVPFHDPWSKLLI 109
             |::|||...||                     .|.|  .||||....   ..|.|.|...::  
 Frog    71 QYIHAVEETVQKLRREQIEQVPDLLSQVQEKYATIQGKNTDEDLKKNG---RFVQFKDQLREM-- 130

  Fly   110 KHPVRNKRCGHIYDRETVLMIIKDNIGIL-------CPV 141
                 .|:.|...:.|.....:.::|.::       ||:
 Frog   131 -----RKQMGEKEEGEGAFENVDEDIAVMPSQQNFTCPI 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42299NP_727866.2 RING 86..144 CDD:302633 12/64 (19%)
nsmce2XP_002938708.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002478
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.