DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and Sprtn

DIOPT Version :8

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001104611.1 Gene:Sprtn / 244666 MGIID:2685351 Length:497 Species:Mus musculus

Alignment Length:565 Identity:183/566 (32%)
Similarity:268/566 (47%) Gaps:129/566 (23%)


  Fly    76 ENSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELVDPTPDIYAMFIRFDEKFFQERL 140
            |..:::..:|.||.::||               :|||..|||||||||:.|:|::|:::||..:|
Mouse    13 EEWDVQMARRAAAAREPV---------------SLVDASWELVDPTPDLQALFLQFNDRFFWGQL 62

  Fly   141 GAVSLEWSKKMYSCAGICYQRGNRFVKQVTIRLSEPLLKLRPRKDLVETLLHEMIHAYCFVLNIR 205
            .||.::||.:|..|||||...|..  ...:||||||||||||||||||||||||||||.||.|..
Mouse    63 EAVEVKWSVRMTLCAGICTYEGRG--GMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNND 125

  Fly   206 EGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHIWRCTGICRERSPFWGYVKRTSNR 270
            :...||||.|.:.|..||::.|.||||||||||||..||.|.|||.|.|:.|.|::|||||.:||
Mouse   126 KDREGHGPEFCKHMHRINQLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRQPYYGYVKRATNR 190

  Fly   271 APGPNDQWWKMHQRECSGTFLKLSEPPK-APKPETKSRAKKSTPAVAAPKEDIRNWFGQPSAKKA 334
            ||..:|.||..||:.|.||::|:.||.. :.|...|::|.|. ||.|...:|             
Mouse   191 APSVHDYWWADHQKTCGGTYIKIKEPENYSKKGRGKTKADKQ-PASAVENKD------------- 241

  Fly   335 ATGTVLLGDLAKAVPPTSYPGLSSEPFAL---PKTPAAGTKGNKSGGFNELDKSGSKATTEMSGQ 396
               .:..|:....:|      .|.:.:.|   ...|:|| |.|.|...||        ...:|.|
Mouse   242 ---KLCRGEAQLLIP------FSGKGYVLGDASTCPSAG-KLNTSYMVNE--------AKGLSSQ 288

  Fly   397 GYSLGGSSAIEHIDLSDTDVPDSAKLRQIRLQRFSEDASNKRQNKKKRRRVS-----SDSEIINW 456
            .:|:.|                      :||...:|....:....||...||     |...::: 
Mouse   289 DHSVSG----------------------LRLNSNAEVKCEQNCLPKKPHLVSPLPTASHQSVLS- 330

  Fly   457 ESYDDDVMV------RDVH-TPIVN------LVESSSDEEEMKMPAGRKTMTSQERTQIIKRQVM 508
             ||...|.|      |:|: :|:.|      ....:|...:.|:|..|.::.:..:........:
Mouse   331 -SYFPRVSVANQKAFRNVNGSPVKNGTTGDGTKRPASGGSQRKVPPSRASLRNTSKVTAPASATV 394

  Fly   509 EDELTLCEDDILLIDDEYDDEVAANESLTAATELA---DQSI-----IDDIFGEDTLLKEFQREN 565
            ..                    ||..|.|.:.|.:   ||.:     ::|....||:.::.|...
Mouse   395 TS--------------------AAGTSATISREESGSEDQFLNKRPRLEDRTALDTIKEQTQSGG 439

  Fly   566 DV----QPSCSSYAKRIEND--IVSCPICFEKMRRTELSNHFDGC 604
            |:    ||:.:|..:.:.:.  :|:||:|...:..::::.|.|.|
Mouse   440 DLRSSSQPTAASAPQSLSSQRRLVNCPVCQGVVVESQINEHLDRC 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 97/170 (57%)
ZnF_Rad18 582..605 CDD:128973 7/24 (29%)
SprtnNP_001104611.1 SprT-like 46..214 CDD:287265 97/170 (57%)
SHP-box 254..262 2/8 (25%)
PIP-box 326..333 2/9 (22%)
ZnF_Rad18 462..485 CDD:128973 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C147078045
eggNOG 1 0.900 E1_KOG3931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004771
OrthoInspector 1 1.000 T1085222
orthoMCL 1 0.900 OOG5_130345
Panther 1 1.100 LDO PTHR21220
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3918
TreeFam 1 0.960
98.730

Return to query results.
Submit another query.