DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC101732098

DIOPT Version :8

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_017953112.1 Gene:LOC101732098 / 101732098 -ID:- Length:241 Species:Xenopus tropicalis

Alignment Length:222 Identity:90/223 (40%)
Similarity:131/223 (59%) Gaps:20/223 (9%)


  Fly    81 KNKKREAAKKKPVRAIQASHDDYLN----KTMNLVDPEWELVDPTPDIYAMFIRFDEKFFQERLG 141
            :|...:|.:|:.| |.|...|..:.    :.:::|||.||::||.|||:|:|..|:::||:..|.
 Frog    31 ENVTSQAREKRSV-ACQTDGDPGVTQPAIEQLSVVDPYWEVLDPKPDIHALFDDFNKRFFRGLLP 94

  Fly   142 AVSLEWSKKMYSCAGICYQRGNRFVKQVTIRLSEPLLKLRPRKDLVETLLHEMIHAYCFVLNIRE 206
            .:.|:||.::...||||.|  :....:..|||::|||.|||||:.||||||||||.|..|....:
 Frog    95 PIDLKWSNRLCITAGICIQ--DNISGKCRIRLNKPLLDLRPRKNTVETLLHEMIHYYQRVRGTSD 157

  Fly   207 GNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHIWRCTGICRERSPFWGYVKRTSNRA 271
            .:  ||..|...||.||:.:|.||||||.|..|..|.:.|.|:|.|.|.:      .|:|.::|.
 Frog   158 ID--HGATFHFHMERINRESGANITVYHDFDREYESLKRHWWKCNGPCAQ------VVRRLADRT 214

  Fly   272 PGPNDQWWKMHQRECSGTFLKLSEPPK 298
            ||.     |.|:|:|.|.|:|:.||.:
 Frog   215 PGS-----KAHKRKCGGEFIKVREPKR 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 72/170 (42%)
ZnF_Rad18 582..605 CDD:128973
LOC101732098XP_017953112.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1171375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.