DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC100489893

DIOPT Version :9

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_031749472.1 Gene:LOC100489893 / 100489893 -ID:- Length:135 Species:Xenopus tropicalis


Alignment Length:130 Identity:49/130 - (37%)
Similarity:69/130 - (53%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KQVTIRLSEPLLKLRPRKDLVETLLHEMIHAYCFVLNIREGNGGHGPNFKRIMETINKVAGTNIT 231
            :|||:.|...|          :||||||||.|..:....:..  ||..|:..|:.||:.:|.|||
 Frog    20 EQVTLGLFLTL----------QTLLHEMIHYYQRLRGTHDLE--HGATFQYHMKRINRESGANIT 72

  Fly   232 VYHTFHDEVASYRTHIWRCTGICRERSPFWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEP 296
            :||.|..|..|.:.|.|:|.|.|::      .|||.::|.||.     |.|:|:|.|.|:|:.||
 Frog    73 IYHDFIQEYESLKRHWWKCNGPCQQ------VVKRLTDRTPGS-----KAHKRKCGGDFIKIQEP 126

  Fly   297  296
             Frog   127  126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 47/126 (37%)
ZnF_Rad18 582..605 CDD:128973
LOC100489893XP_031749472.1 DUF45 <31..123 CDD:418551 41/104 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1171375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.