DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC100489893

DIOPT Version :8

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_002932490.2 Gene:LOC100489893 / 100489893 ID: Length:194 Species:Xenopus tropicalis

Alignment Length:244 Identity:72/244 - (29%)
Similarity:107/244 - (43%) Gaps:65/244 - (26%)


  Fly    54 SELDSSIQFVYPKSNQPKSTKMENSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELV 118
            |..|||.:: |...|.|      :....|:..|....:...::....|....|.:::|||.||::
 Frog     6 STSDSSSEY-YTAPNSP------DLSFNNQSNENFTSQEKHSVACQTDLSFQKDLSIVDPYWEVL 63

  Fly   119 DPTPDIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGIC-YQRGNRFVKQVTIRLSEPLLKLRP 182
            ||.|||..:|..|:.|||..:|..:.|:||.::...||:| |.......|   |||::|||:||.
 Frog    64 DPKPDIRILFEEFNTKFFGGQLPPIDLKWSNRLCIDAGLCIYNTRTGICK---IRLNKPLLELRA 125

  Fly   183 RKDLVETLLHEMIHAYCFVLNIREGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHI 247
            |||.|:                                           :||.|..|..|.:.|.
 Frog   126 RKDTVQ-------------------------------------------IYHDFIQEYESLKRHW 147

  Fly   248 WRCTGICRERSPFWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEP 296
            |:|.|.|::      .|||.::|.||.     |.|:|:|.|.|:|:.||
 Frog   148 WKCNGPCQQ------VVKRLTDRNPGT-----KAHKRKCGGDFIKIQEP 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 50/170 (29%)
ZnF_Rad18 582..605 CDD:128973
LOC100489893XP_002932490.2 DUF45 69..182 CDD:302795 49/169 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1171375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.