DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC100485137

DIOPT Version :8

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_012808209.1 Gene:LOC100485137 / 100485137 ID: Length:236 Species:Xenopus tropicalis

Alignment Length:250 Identity:88/250 - (35%)
Similarity:140/250 - (56%) Gaps:22/250 - (8%)


  Fly    67 SNQPKSTKMENSEIK--NKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELVDPTPDIYAMFI 129
            :|...|..:||..:.  |.:.|.::..|      :::...:::.:::||.||.:||.||...::.
 Frog     5 NNPSTSNNLENPNLSTFNTEGENSQNLP------ANNPPADRSYSIIDPIWETLDPNPDPQILYN 63

  Fly   130 RFDEKFFQERLGAVSLEWSKKMYSCAGICYQRGNRFVKQV--TIRLSEPLLKLRPRKDLVETLLH 192
            :|::..|...|..|.::||.:|....|:||...|:....:  .||||:.:|:||.|||:||:|||
 Frog    64 QFNKIIFGGTLPTVDVKWSNRMTRSTGVCYHSLNKSGDCIGCRIRLSKKILELRRRKDMVESLLH 128

  Fly   193 EMIHAYCFVLNIREGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHIWRCTGICRER 257
            ||||......|..:....|||||:..||..|...|||||:.|||::||.:.:.|.|.|.|.|:  
 Frog   129 EMIHVLLCSTNNMDPGDDHGPNFRLTMEVFNNSFGTNITISHTFYEEVEAIKRHWWECDGPCQ-- 191

  Fly   258 SPFWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEPPKAPKPETKSRAKKST 312
                ..|||.:||||...::|::.|::.|.|:|:|.||      ||..:|.::.|
 Frog   192 ----NVVKRATNRAPSSKERWFREHEQTCGGSFIKTSE------PEGPARKRRRT 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 67/171 (39%)
ZnF_Rad18 582..605 CDD:128973
LOC100485137XP_012808209.1 SprT-like 61..224 CDD:287265 67/168 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395183at33208
OrthoFinder 1 1.000 FOG0004771
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.