DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg14 and AT4G18230

Sequence 1:NP_573031.1 Gene:Alg14 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001328332.1 Gene:AT4G18230 AraportID:AT4G18230 Length:233 Species:Arabidopsis thaliana

Alignment Length:197 Identity:78/198 (39%)
Similarity:119/198 (60%) Gaps:21/198 (11%)


  Fly     4 SSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSERQFRQVLPQAAQ 68
            |....|.::||||||||||..|...|       :.:::.|...|.|.:|:.|.::.|......|:
plant    49 SQSFTTLIVLGSGGHTAEMLSLLSVL-------RKDRFTPRFYIAAATDNMSLQKARSFEDSLAE 106

  Fly    69 R-------AEFVKVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDRPQLILCNGPGTCVPFCYAA 126
            :       ::|:::.|||:||||:::|::|::.|:|.:.:|:.|.|||:|||||||||:|.|..|
plant   107 KPAVKEASSQFMQIYRSREVGQSYVTSVWTTIVAILHALWLMIRIRPQVILCNGPGTCIPLCVIA 171

  Fly   127 YLWRLLGRLPSHSRIVFVESFCRVETLSLSGRLL--LPLADLFVVHWPALATRYLDKKNVRYFGR 189
            :|:::||  ...|.|.:|||..||:.|||||.||  |.:||.|.|.||.|..:|   ....|.|.
plant   172 FLFKVLG--IRWSSIFYVESVARVKKLSLSGLLLYKLRIADQFFVQWPQLHKKY---PRAHYVGC 231

  Fly   190 IL 191
            ::
plant   232 LM 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 77/190 (41%)
AT4G18230NP_001328332.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H49751
Inparanoid 1 1.050 130 1.000 Inparanoid score I1831
OMA 1 1.010
OrthoDB 1 1.010 D1449763at2759
OrthoInspector 1 1.000 T193398
orthoMCL 1 0.900 OOG5_128444
Panther 1 1.100 LDO PTHR12154
Phylome 1 0.910 0.974 Consistency score
98.980

Return to query results.
Submit another query.