DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg14 and Alg14

Sequence 1:NP_573031.1 Gene:Alg14 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006501962.1 Gene:Alg14 MGIID:1914039 Length:222 Species:Mus musculus

Alignment Length:214 Identity:87/215 (40%)
Similarity:119/215 (55%) Gaps:39/215 (18%)


  Fly     2 TTSSPHPT--------YVILGS-----GGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDS 53
            |...||..        .::.||     ||||.|:.||..:|        :..|.|...::|.||.
Mouse    24 TVLGPHHVTPRESLRLLIVAGSVFLFLGGHTTEILRLVGSL--------SNAYSPRHYVIAESDE 80

  Fly    54 TSERQFRQVLPQAAQRA------EFVK-----VPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDR 107
            .|.::...:  :...||      |:.|     :||||:|.||||||:||:.:::.:|..||.|.:
Mouse    81 MSAKKIHSL--EELSRAQNDSTTEYPKYHLHRIPRSREVRQSWLSSVFTTFYSMWFSFPLVLRIK 143

  Fly   108 PQLILCNGPGTCVPFCYAAYLWRLLGRLPSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWP 172
            |.|:||||||||||.|.:|.|..:||  .....||:|||.||||||||||::|..|:|.|:|.||
Mouse   144 PDLVLCNGPGTCVPICVSALLLGILG--VKKVIIVYVESICRVETLSLSGKILRHLSDYFIVQWP 206

  Fly   173 ALATRYLDKKNVRYFGRIL 191
            .|..:|  .|:| |.|||:
Mouse   207 TLKEKY--PKSV-YLGRIV 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 83/205 (40%)
Alg14XP_006501962.1 Alg14 39..221 CDD:285823 81/187 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C199090861
eggNOG 1 0.900 E1_KOG3339
Hieranoid 1 1.000
Homologene 1 1.000 H49751
Inparanoid 1 1.050 140 1.000 Inparanoid score I4448
Isobase 1 0.950 0 Normalized mean entropy S2002
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004500
OrthoInspector 1 1.000 T1085223
orthoMCL 1 0.900 OOG5_128444
Panther 1 1.100 LDO PTHR12154
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R39
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.