DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg14 and alg14

Sequence 1:NP_573031.1 Gene:Alg14 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001006092.1 Gene:alg14 ZFINID:ZDB-GENE-041010-195 Length:219 Species:Danio rerio

Alignment Length:186 Identity:81/187 (43%)
Similarity:110/187 (59%) Gaps:18/187 (10%)


  Fly    11 VILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSE---RQFRQVLPQAAQRAEF 72
            |:.||||||.|:.||..:|        :..|.|...::|::|..||   |.|.....::...::|
Zfish    47 VVAGSGGHTTEIIRLLGSL--------SHSYNPRHYVIADTDKMSEEKIRTFEAEREKSDSTSQF 103

  Fly    73 V--KVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDRPQLILCNGPGTCVPFCYAAYLWRLLGRL 135
            .  ::||||:|.|||.||:.:||.||..|..||:|.||.::||||||||||.|.|..|..:||. 
Zfish   104 TLQRIPRSREVRQSWSSSVLSSLNALFSSVPLVFRLRPDVVLCNGPGTCVPLCAAGLLLGILGL- 167

  Fly   136 PSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL 191
             ....||:|||.||||||||||::|..::|.|.|.|..|..:|   .|..|.||::
Zfish   168 -KRVLIVYVESICRVETLSLSGKMLYYISDYFFVQWAQLKDKY---PNAIYMGRLV 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 81/184 (44%)
alg14NP_001006092.1 Alg14 45..218 CDD:285823 81/184 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C199088966
eggNOG 1 0.900 E1_KOG3339
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H49751
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1449763at2759
OrthoFinder 1 1.000 FOG0004500
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128444
Panther 1 1.100 LDO PTHR12154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.