DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg14 and Alg14

Sequence 1:NP_573031.1 Gene:Alg14 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_008759687.1 Gene:Alg14 RGDID:1312003 Length:263 Species:Rattus norvegicus

Alignment Length:257 Identity:80/258 (31%)
Similarity:105/258 (41%) Gaps:94/258 (36%)


  Fly     7 HPT--------YVILGSGGHTAEMCRLTQAL----------LQQTDIEQTEKYQPIRLILANSDS 53
            ||.        .::.||||||||:.||..:|          :.::|....:|...:.|..|.:||
  Rat    29 HPVTPRQSLGLLIVAGSGGHTAEILRLVGSLSGAYSPRHYVIAESDEMSAKKIHSLELARAQNDS 93

  Fly    54 TSE---RQFRQVLPQAAQRAEFVKVPRSRDVGQSWLSSIFTSLWALLWSCYLV------------ 103
            |:|   ....:|||.          |.|...|.|       ::.|||...|||            
  Rat    94 TTEVCDHFSHRVLPS----------PNSEKPGGS-------AVLALLRVHYLVLHMVFLPTGSPN 141

  Fly   104 ---------------------------------------WRDRPQLILCNGPGTCVPFCYAAYLW 129
                                                   |......:||||||||||.|.:|.|.
  Rat   142 KARLVPLPSLPAPRGSLLLFPDPALFQNFTPWWLPGKAEWGWTAMEVLCNGPGTCVPICVSALLL 206

  Fly   130 RLLGRLPSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL 191
            .:||  .....||:|||.||||||||||::|..|:|.|:|.||.|..:|  .|:| |.|||:
  Rat   207 GILG--IKKVIIVYVESICRVETLSLSGKILWHLSDYFIVQWPTLKEKY--PKSV-YLGRIV 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 77/253 (30%)
Alg14XP_008759687.1 Glycosyltransferase_GTB_type 39..262 CDD:299143 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C199090247
eggNOG 1 0.900 E1_KOG3339
Hieranoid 1 1.000
Homologene 1 1.000 H49751
Inparanoid 1 1.050 144 1.000 Inparanoid score I4298
OMA 1 1.010
OrthoDB 1 1.010 D1449763at2759
OrthoFinder 1 1.000 FOG0004500
OrthoInspector 1 1.000 T1088773
orthoMCL 1 0.900 OOG5_128444
Panther 1 1.100 LDO PTHR12154
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.