DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg14 and alg14

Sequence 1:NP_573031.1 Gene:Alg14 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_593363.1 Gene:alg14 PomBaseID:SPAC5D6.06c Length:210 Species:Schizosaccharomyces pombe

Alignment Length:183 Identity:79/184 (43%)
Similarity:108/184 (59%) Gaps:19/184 (10%)


  Fly    11 VILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSERQFRQVLPQA--AQRAEFV 73
            |..||||||.||..|..||        .:|...:|..:|.||.|.......:|..:  :.:::..
pombe    39 VFFGSGGHTGEMLNLLNAL--------DDKLYSVRSYVAGSDDTMSVSKASLLSNSLPSVKSKIF 95

  Fly    74 KVPRSRDVGQSWLSSIFTSLWALLWSCYLV-WR--DRPQLILCNGPGTCVPFCYAAYLWRLLGRL 135
            ||||:|.|.||||::.||:.|:||.|..:: |.  ..|.:||||||||||..|...||.:.||: 
pombe    96 KVPRARYVKQSWLTTPFTAFWSLLGSISVIFWNPFGIPDVILCNGPGTCVFICLLGYLAKFLGK- 159

  Fly   136 PSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFG 188
              :.:||:||||.||::|||||::|:|..|.|:|.||.|||:|   |...|.|
pombe   160 --NVKIVYVESFARVKSLSLSGKILMPFVDRFLVQWPDLATKY---KRAEYIG 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 79/184 (43%)
alg14NP_593363.1 Alg14 37..209 CDD:285823 79/184 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H49751
Inparanoid 1 1.050 135 1.000 Inparanoid score I1382
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004500
OrthoInspector 1 1.000 T1125785
orthoMCL 1 0.900 OOG5_128444
Panther 1 1.100 LDO PTHR12154
Phylome 1 0.910 0.980 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R39
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.