powered by:
Protein Alignment CG15642 and R01H2.8
DIOPT Version :10
| Sequence 1: | NP_573028.1 |
Gene: | CG15642 / 32476 |
FlyBaseID: | FBgn0030642 |
Length: | 183 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001076644.1 |
Gene: | R01H2.8 / 4927043 |
WormBaseID: | WBGene00045190 |
Length: | 124 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 50 |
Identity: | 12/50 - (24%) |
| Similarity: | 18/50 - (36%) |
Gaps: | 21/50 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 LPAMVFLRLSAAGRSLWLRIITNAVFALIVLEVIVSLVHFVICKPGCKLP 142
|..::|| |:...:|||.|:..|:. ||..|
Worm 25 LVTLIFL------------IVIFTIFALAVIGAILI---------GCLKP 53
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG15642 | NP_573028.1 |
Transmemb_17 |
16..121 |
CDD:462907 |
6/27 (22%) |
| R01H2.8 | NP_001076644.1 |
None |
Return to query results.
Submit another query.
