DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6294 and YIL108W

Sequence 1:NP_573026.1 Gene:CG6294 FlyBaseID:FBgn0030640 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_012158.1 Gene:YIL108W SGDID:S000001370 Length:696 Species:Saccharomyces cerevisiae

Alignment Length:448 Identity:100/449 (22%)
Similarity:151/449 (34%) Gaps:128/449 (29%)


  Fly    22 SERLEHSLLLVKGRLVPKCSTARQLKAI---------LDLPEHLSQEQLTQLSAGGEFKLLFDLE 77
            :|::....|:|.|    ||:.....|.:         :..|.|....:.|.:...||.||.|   
Yeast    15 NEQIVSPCLIVHG----KCNKQNGAKTVQVQHPQLPPITYPIHNQFFKATVILTPGENKLTF--- 72

  Fly    78 QANREEEEEESACLLELRSCTATRTISFSYRPRRSSYRVQPLYLLCQD---------EEKTLAQQ 133
                            :......|||...|.|...:..|....:|.:|         |:|.....
Yeast    73 ----------------VTDTNTARTIVCYYTPLTQNPPVHLCLILAKDSPLQFDSPREQKDREGG 121

  Fly   134 HEVHSLID---LNLRLVQSIYAHKLHAAGFPNRTF---------TL--------NGKCCAFRSQL 178
            :.:...|.   |..||:|:....::......||||         ||        ..|....||:.
Yeast   122 NGLELAIKKLRLGARLMQAYTNEQMLRNSMGNRTFPFVEEFTWDTLFERPAMRNTIKIHVVRSEK 186

  Fly   179 TRKQALAKSEDELWQHFAGE---------IIACPQWGH---------QLLLKFVAFVGCTRYDGD 225
            |.|:  .:..|...|:..|:         :.|...:|.         |....|:.    |.:|| 
Yeast   187 TVKE--IQDPDIAQQNSKGKNTGALFGIAMDALKSYGGPFTNNEKPVQAACMFLD----THWDG- 244

  Fly   226 AVVASGDSSYANIRRHLKGHAALGGGG----LALFGSAHFYAWPTSFAEIGDCVRSAQRVDIARL 286
                          :.::||||||||.    ||:|||...|:|||...::........|...:.:
Yeast   245 --------------KLIRGHAALGGGDDSIKLAIFGSHGLYSWPTCLEQLVPYFTDETRSSTSEV 295

  Fly   287 PDESNYRRTYGGVYASTLGAVCHELGHCFDLGHTSEGVMGQGFDYLNRVLTVDQPTEHLPQRIVD 351
            .::.|...||......||||..||:||.....|...|||.:|:..|||...              
Yeast   296 ANDCNECGTYWECLTITLGAFMHEIGHLLGCPHQESGVMLRGYTTLNRSFL-------------- 346

  Fly   352 ARRGSLANTNSSEGGSSSSSSTSSSSSSAGSGAATGNRARLTKLKLQPSSQLLDNYHN 409
                      :.|..|..::||.:|.........|.||....:....||..|..:|::
Yeast   347 ----------TKEAYSVRTNSTGASPPIFPKEECTWNRLDTVRFLYHPSFTLPQDYYD 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6294NP_573026.1 Metallopep 13..350 CDD:288865 88/388 (23%)
YIL108WNP_012158.1 Metallopep 7..430 CDD:314854 100/449 (22%)
Jacalin_metallopeptidase_like 533..694 CDD:187709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140917717
eggNOG 1 0.900 E1_KOG4525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0012243
OrthoInspector 1 1.000 T1136789
orthoMCL 1 0.900 OOG5_133660
Panther 1 1.100 LDO PTHR21054
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.