DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6294 and SPAC607.06c

Sequence 1:NP_573026.1 Gene:CG6294 FlyBaseID:FBgn0030640 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_593595.1 Gene:SPAC607.06c PomBaseID:SPAC607.06c Length:612 Species:Schizosaccharomyces pombe

Alignment Length:370 Identity:76/371 (20%)
Similarity:141/371 (38%) Gaps:104/371 (28%)


  Fly    22 SERLEHSLLLVKGRLVPKCSTARQLKAILDLPEHLSQ--EQ---LTQL-------SAGGEFKLLF 74
            :|.:.:..:::.||:.|:.|...|   .:::..|.:.  ||   :|.|       ...|:..:||
pombe    12 NETVYNRFVIIHGRVGPRASYCPQ---TINVKHHENSFPEQTWVVTDLYFKAIIHVVPGDNTILF 73

  Fly    75 DLEQANREEEEEESACLLELRSCTATRTISFSYRPRRSSYRVQPLYLLC----QDEEKTLAQQHE 135
            ..:...:.|.:.....|::                       .|.|.:.    :|.:.:....|.
pombe    74 TTDDGGKLELQVYYQLLVD-----------------------NPFYCIAFIVGKDSDLSFDAPHG 115

  Fly   136 VHSLIDLNLR-------LVQSIYAHKLHAAGFPNRTF------------------------TLNG 169
            ..:.||..:|       |.|:..|..::..|:..|:|                        |:| 
pombe   116 AKNDIDEGIRKLRCAAYLWQAFTAECMYRNGYGRRSFRIEESVQPDTMSCLSPWGTERLTATIN- 179

  Fly   170 KCCAFRSQLTRKQALAKSEDELWQHFAGEII---ACPQWGHQLLLKFVAFVGCTRYDGDAVVASG 231
               ..||..|.::..:...|:|: |.||:.:   ..|:..|.:.:    |:. ||||...     
pombe   180 ---ILRSDKTAEEIRSVPPDQLF-HIAGDAVDKLHLPEPWHYMCM----FLD-TRYDPST----- 230

  Fly   232 DSSYANIRRHLKGHAALGGG----GLALFGSAHFYAWPTSFAEIGDCVRSAQRVDIARLPDESNY 292
                    :.::||.|||||    .|.:|||...:::|::...:......|:|:. :.|.:::|.
pombe   231 --------QKIRGHVALGGGTDMHKLGVFGSHSLHSFPSALEYVVPVFSDARRIP-SYLANDANE 286

  Fly   293 RRTYGGVYASTLGAVCHELGHCFDLGHTSEGVMGQGFDYLNRVLT 337
            ..|........:||:.|||||.....|..:|:|.:.:...||..|
pombe   287 SSTIWECANIGIGAMLHELGHTLGCPHQPDGIMLRSYPIFNRSFT 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6294NP_573026.1 Metallopep 13..350 CDD:288865 76/371 (20%)
SPAC607.06cNP_593595.1 Metallopep 3..402 CDD:288865 76/371 (20%)
Jacalin_like 491..612 CDD:295729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0012243
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133660
Panther 1 1.100 LDO PTHR21054
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.