DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9072 and RBL2

DIOPT Version :10

Sequence 1:NP_573002.1 Gene:CG9072 / 32443 FlyBaseID:FBgn0030614 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_014908.1 Gene:RBL2 / 854439 SGDID:S000005791 Length:106 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:21/78 - (26%)
Similarity:42/78 - (53%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QLIVYRALLQHLLQQKDHYDHE---RELELQRLERFRSEGANERRLQIQEQVLKKAQGMLPGIVF 102
            ||.:....|:.|.:::.:|..|   :|..:.:|:..:|  .:...|:.||:||...:.:||.:..
Yeast     5 QLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKS--VDPYDLKKQEEVLDDTKRLLPTLYE 67

  Fly   103 KMRNEVDKLKRFL 115
            |:|...:.|::||
Yeast    68 KIREFKEDLEQFL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9072NP_573002.1 TBCA 37..138 CDD:460769 21/78 (27%)
RBL2NP_014908.1 TBCA 1..96 CDD:460769 21/78 (27%)

Return to query results.
Submit another query.