DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9072 and TBCA

DIOPT Version :10

Sequence 1:NP_573002.1 Gene:CG9072 / 32443 FlyBaseID:FBgn0030614 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001284667.1 Gene:TBCA / 6902 HGNCID:11579 Length:129 Species:Homo sapiens


Alignment Length:81 Identity:18/81 - (22%)
Similarity:48/81 - (59%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SDPRLEQLIVYRALLQHLLQQKDHYDHERELELQRLERFRSEGANERRLQIQEQVLKKAQGMLPG 99
            :|||:.|:.:...:::.|:::|..|:.|.:.:.:::|:.|:|......::.|.::|::::.|:|.
Human     2 ADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPD 66

  Fly   100 IVFKMRNEVDKLKRFL 115
            ...::......|:|.|
Human    67 CQRRLEAAYLDLQRIL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9072NP_573002.1 TBCA 37..138 CDD:460769 17/79 (22%)
TBCANP_001284667.1 TBCA 4..84 CDD:460769 17/79 (22%)

Return to query results.
Submit another query.