DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5599 and AT3G13930

Sequence 1:NP_573000.1 Gene:CG5599 FlyBaseID:FBgn0030612 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_566470.1 Gene:AT3G13930 AraportID:AT3G13930 Length:539 Species:Arabidopsis thaliana

Alignment Length:476 Identity:144/477 (30%)
Similarity:227/477 (48%) Gaps:51/477 (11%)


  Fly    14 LLRNCISQRAALRRCLHVTSSLDKTVSFNLSDIGEGIREVTVKEWFVKEGDTVEQFDNLCEVQSD 78
            |.:..||.:....|....:|.|.......:..:...:.|..:..|..||||.|...:.||||::|
plant    87 LFKEFISSQMRSVRGFSSSSDLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETD 151

  Fly    79 KASVTITSRYDGKITKI--HHKIDEIALVGKPLLDFDVVNEDEDEPEDSSSSSSSTSSDSSASE- 140
            ||:|.:....:|.:.||  .....||. ||:.:.   :..||||:.:.....:.|:.:..:|.| 
plant   152 KATVEMECMEEGFLAKIVKEEGAKEIQ-VGEVIA---ITVEDEDDIQKFKDYTPSSDTGPAAPEA 212

  Fly   141 -------NEEKQSAEASA----------TPTEGRVIIPATPSVRRLAKEHQLDLAKVPATGKNGR 188
                   .|||....|||          .|:|.|:.  |:|..|:||:::.:.|:.:..||..||
plant   213 KPAPSLPKEEKVEKPASAPEAKISKPSSAPSEDRIF--ASPLARKLAEDNNVPLSSIKGTGPEGR 275

  Fly   189 VLKGDILEFLGQVPPGTNVPHPTLLAKTPSAAPSGAASVSVPA-DRVEV-LKGVRKAMLKSMTES 251
            ::|.|:.:||...            :|..:|.||......||| |.|:: ...:||.....:..|
plant   276 IVKADVEDFLASG------------SKETTAKPSKQVDSKVPALDYVDIPHTQIRKVTASRLAFS 328

  Fly   252 LK-IPHFAYSDEIDMTQLMQFRNQLQLVAKENGVPKLTFMPFCIKAASIALSKYPIVNSSLDLAS 315
            .: |||:..:.:..:.::|..|:||....:.:|..:::.....||||::||.|.|..|||.   :
plant   329 KQTIPHYYLTVDTCVDKMMGLRSQLNSFQEASGGKRISVNDLVIKAAALALRKVPQCNSSW---T 390

  Fly   316 ESLV--FKGAHNISVAIDTPQGLVVPNIKNCQTKTIIEIAKDLNALVERGRTGSLSPADFADGTF 378
            :..:  ||.. ||:||:.|..||.||.:|:...|.:..|.:::..|.::.:..||.|.|:..|||
plant   391 DEYIRQFKNV-NINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTF 454

  Fly   379 SLSNI-GVIGGTYTHPCIMAPQVAIGAMG--RTKAVPRFNDKDEVVKAYVMSVSWSADHRVIDGV 440
            ::||: |..|.......|..||.||.|:|  ..:.||........|.:| |||:.|.|||||||.
plant   455 TVSNLGGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGPDQYNVASY-MSVTLSCDHRVIDGA 518

  Fly   441 TMASFSNVWKQYLENPALFLL 461
            ..|.:...:|.|:|.|...||
plant   519 IGAEWLKAFKGYIETPESMLL 539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5599NP_573000.1 lipoyl_domain 39..109 CDD:133458 22/72 (31%)
PLN02528 41..462 CDD:215289 138/450 (31%)
E3_binding 161..194 CDD:280908 12/33 (36%)
2-oxoacid_dh 248..461 CDD:278621 74/219 (34%)
AT3G13930NP_566470.1 PLN02744 1..539 CDD:215397 143/475 (30%)
lipoyl_domain 112..185 CDD:133458 22/77 (29%)
E3_binding 248..281 CDD:280908 12/35 (34%)
2-oxoacid_dh 328..539 CDD:278621 74/216 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43178
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.