DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5599 and pdx1

Sequence 1:NP_573000.1 Gene:CG5599 FlyBaseID:FBgn0030612 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_588065.1 Gene:pdx1 PomBaseID:SPCC1259.09c Length:456 Species:Schizosaccharomyces pombe

Alignment Length:423 Identity:104/424 (25%)
Similarity:183/424 (43%) Gaps:80/424 (19%)


  Fly     1 MATHLLRNGATCWLLRNCISQRAALRRCLHVTSSLDKTVS-FNLSDIGEGIREVTVKEWFVKEGD 64
            |..|.:..   |....:|....:..:|..| .|:|:...| |.:..:...:.|..:.:|..||||
pombe     1 MLKHYIHQ---CVKASSCKHSLSVKQRYFH-CSALNGVASMFRMPALSPTMEEGNITKWHFKEGD 61

  Fly    65 TVEQFDNLCEVQSDKASVTITSRYDGKITKIHHKIDEIALVGKPLLDFDVVNEDEDE------PE 123
            :.:..|.|.||::|||::.:..:.:|.:.|:..:......|||   :..:|.:.||.      |:
pombe    62 SFKSGDILLEVETDKATMDVEVQDNGILAKVLIEKGSNIPVGK---NIAIVADAEDNLKDLELPK 123

  Fly   124 DSSSSSSSTSSDSS------ASENEEKQSAEASATPTEGRVIIPA-TPSVRRLAKEHQLDLA-KV 180
            |.:||...:.|.|.      ..:.|.|.:.|..:|......:..: .|||..|..:::::.. .:
pombe   124 DEASSEEQSFSSSKEEVKPIVQDRETKSNVEHKSTSQANDAVNKSFLPSVSYLIHQYKIENPWSI 188

  Fly   181 PATGKNGRVLKGDILEFLGQVPPGTNVPHPTLLAK------------TPSAAPSGAASVSVPADR 233
            ||||.:||:||||:|..:|::..|.    |:.|.|            .....||.... |||   
pombe   189 PATGPHGRLLKGDVLAHVGKIDKGV----PSSLQKFVRNLEVLDFSGVEPKKPSYTED-SVP--- 245

  Fly   234 VEVLKGVRKAMLKSMTESLK-IP----HFAYSDEIDMTQLMQFRNQLQLVAKEN-----GVPKLT 288
                  |||:   :|.|:|| :|    :..:...|.:.:|.      .|:||..     |:.::.
pombe   246 ------VRKS---TMIETLKTVPMKDEYITFERSISLEKLK------SLLAKRKEKDAFGIDEVV 295

  Fly   289 FMPFCIKAASIA-LSKYPIVNSSLDLASESLVFKGAHNISVAIDTPQGLVVPNIKNCQTKTIIEI 352
             ......|.||: |||  :..:|::.|.:.|:......:..::...|..:.|  ||..||.:.:.
pombe   296 -SAMIGDALSISELSK--VEPNSIESAYDLLLGAPIVKLKSSVSNFQPKLFP--KNNNTKDLHKY 355

  Fly   353 AKDLNALVERGRTGSLS---PADFADGTFSLSN 382
            .:|  :::  |...:||   ..:|:..|.|.||
pombe   356 IRD--SMI--GLPSNLSDYVKLNFSSVTKSSSN 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5599NP_573000.1 lipoyl_domain 39..109 CDD:133458 20/71 (28%)
PLN02528 41..462 CDD:215289 95/383 (25%)
E3_binding 161..194 CDD:280908 14/35 (40%)
2-oxoacid_dh 248..461 CDD:278621 35/150 (23%)
pdx1NP_588065.1 AceF 35..455 CDD:223582 96/386 (25%)
lipoyl_domain 38..109 CDD:133458 19/74 (26%)
E3_binding 171..202 CDD:280908 14/31 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.765 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.