DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B18 and Ndufb7

DIOPT Version :8

Sequence 1:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_080119.1 Gene:Ndufb7 / 66916 MGIID:1914166 Length:137 Species:Mus musculus

Alignment Length:114 Identity:61/115 (53%)
Similarity:78/115 (68%) Gaps:2/115 (2%)


  Fly     1 MGNALT--HYMKPDVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLPLEFRDYCAHLAIA 63
            ||..||  :.....|.|.|:.:|:|.|.|||..||||||:|||:||..|:|.|:.||||||..|.
Mouse     1 MGAHLTRRYLWDASVEPDPEKIPSFPPDLGFPERKERVMVATQQEMMDAQLTLQQRDYCAHYLIR 65

  Fly    64 YQACRSDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEFERERRLLERQKR 112
            ...|:.|:||....|.|::|::..||:.|||.||||||||||||:|:||
Mouse    66 LLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKR 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 31/62 (50%)
Ndufb7NP_080119.1 NDUF_B7 40..100 CDD:310348 29/60 (48%)
Cx9C motif 1. {ECO:0000255|PROSITE-ProRule:PRU01150} 59..69 4/10 (40%)
Cx9C motif 2. {ECO:0000255|PROSITE-ProRule:PRU01150} 80..90 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179583913
eggNOG 1 0.900 E1_KOG3468
Hieranoid 1 1.000
Homologene 1 1.000 H3059
Inparanoid 1 1.050 122 1.000 Inparanoid score I4694
Isobase 1 0.950 0 Normalized mean entropy S3726
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006537
OrthoInspector 1 1.000 T1085235
orthoMCL 1 0.900 OOG5_130434
Panther 1 1.100 LDO PTHR20900
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2667
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.