DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and LEE1

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_015271.1 Gene:LEE1 SGDID:S000005975 Length:301 Species:Saccharomyces cerevisiae

Alignment Length:103 Identity:23/104 (22%)
Similarity:30/104 (29%) Gaps:55/104 (53%)


  Fly     6 SQTICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISEIADEVVENEQVVASTSSYSRQMTWANA 70
            |...|:|..:|.|:.|..|.|||         ||.|...|:                      |.
Yeast    89 SHVPCKFFKMGNCQAGSSCPFSH---------SPDIISSAN----------------------NL 122

  Fly    71 PEFVPRYKANSADFQATEGVQDICPY--GGSCIWGSKC 106
            |                      |.|  .|:|.:|:||
Yeast   123 P----------------------CKYFAKGNCKFGNKC 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 10/24 (42%)
PHA03096 <80..239 CDD:222981 7/30 (23%)
RING 159..213 CDD:238093
LEE1NP_015271.1 YTH1 1..301 CDD:227416 23/104 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48586109
eggNOG 1 0.900 E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2178
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.