DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and AT3G08505

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001325802.1 Gene:AT3G08505 AraportID:AT3G08505 Length:323 Species:Arabidopsis thaliana

Alignment Length:283 Identity:91/284 (32%)
Similarity:141/284 (50%) Gaps:28/284 (10%)


  Fly     9 ICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISEIA---------DEVVENEQVVASTSSYSRQ 64
            :|:|.:.|.|..|:.|.||||...|.:|......:..         |.|.....:..|:.|.|..
plant     6 LCKFFVHGSCLKGENCEFSHDSKDPPNNVCTFYQKRICLYGSRCRYDHVRAASNLPLSSDSESLD 70

  Fly    65 MTWANAPEFVPRYKANSADFQATEGV-------QDICPY--GGSCIWGSKCSYPLHMEICKMCDL 120
            .:.:..|....:.:.::.|...:..|       ..||.:  .|.|..|::|.: :|.::|..|..
plant    71 RSISTTPSRHLQQQGDNNDGDKSSNVYCIHPREYPICSFAAAGDCPRGNQCPH-MHGDLCNTCGK 134

  Fly   121 YCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEK-KGRERRFGILSKCK 184
            .||||....:|..|.:|| |:.::.:|   |:.:|:|..|.:|.|.::.| ...||:||:|::|.
plant   135 KCLHPFRPEEREEHTKEC-EKKQKHIE---ALKQSQDIECSVCLDRILSKATPGERKFGLLTECD 195

  Fly   185 HIFCLTCIRTWRQAHQFEA----TVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGA 245
            |.||:.|||.||.:.....    :..|.||.||..|.||.||..|..:.|||.:::..|:|.:.:
plant   196 HPFCIQCIRNWRSSAPVSGMDVNSTLRACPICRKLSYFVVPSVVWYSSPEEKKEIIDIYKAKLRS 260

  Fly   246 KDCKYFNGGLGKCPFGNKCFYRH 268
            .|||:||.|.|.||||..|||:|
plant   261 IDCKHFNFGNGNCPFGASCFYKH 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 10/21 (48%)
PHA03096 <80..239 CDD:222981 56/173 (32%)
RING 159..213 CDD:238093 22/59 (37%)
AT3G08505NP_001325802.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1488
OMA 1 1.010
OrthoDB 1 1.010 D1388677at2759
OrthoInspector 1 1.000 T32319
orthoMCL 1 0.900 OOG5_129951
Panther 1 1.100 O PTHR11224
Phylome 1 0.910 0.889 Consistency score
87.980

Return to query results.
Submit another query.