powered by:
Protein Alignment CG5347 and Rnf141
DIOPT Version :9
| Sequence 1: | NP_572970.1 |
Gene: | CG5347 / 32403 |
FlyBaseID: | FBgn0030578 |
Length: | 285 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_080275.2 |
Gene: | Rnf141 / 67150 |
MGIID: | 1914400 |
Length: | 230 |
Species: | Mus musculus |
| Alignment Length: | 79 |
Identity: | 23/79 - (29%) |
| Similarity: | 30/79 - (37%) |
Gaps: | 20/79 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 157 DKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCP 221
::.|.||.| .|..::..|.|.||..||..|...| |.||.||: :....
Mouse 152 EEECCICMD---------GRADLILPCAHSFCQKCIDKWSDRH-------RNCPICRL--QMTGA 198
Fly 222 SAYWV--DTKEEKD 233
:..|| |...|.|
Mouse 199 NESWVVSDAPTEDD 212
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1039 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.