DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and Rnf141

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_080275.2 Gene:Rnf141 MGIID:1914400 Length:230 Species:Mus musculus

Alignment Length:79 Identity:23/80 (29%)
Similarity:30/80 (38%) Gaps:20/80 (25%)


  Fly   157 DKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCP 221
            ::.|.||.|         .|..::..|.|.||..||..|...|       |.||.||:  :....
Mouse   152 EEECCICMD---------GRADLILPCAHSFCQKCIDKWSDRH-------RNCPICRL--QMTGA 198

  Fly   222 SAYWV--DTKEEKD 233
            :..||  |...|.|
Mouse   199 NESWVVSDAPTEDD 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 23/80 (29%)
RING 159..213 CDD:238093 17/54 (31%)
Rnf141NP_080275.2 zf-RING_2 153..192 CDD:290367 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.