DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and Mkrn2

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_075779.2 Gene:Mkrn2 MGIID:1914277 Length:416 Species:Mus musculus

Alignment Length:321 Identity:117/322 (36%)
Similarity:163/322 (51%) Gaps:62/322 (19%)


  Fly     5 RSQTICRFHLLGICRFGDLCRFSHDE--------TTPNDNQSPQIS--------EIADEVV---- 49
            :..|||:::..|.|.:|..||:.|.:        ..|..|.||...        :||..|:    
Mouse    32 KPSTICKYYQKGYCAYGARCRYDHTKPPAAAGGAVGPAPNPSPSSGLHSPHPSPDIATSVMRTHS 96

  Fly    50 ------ENEQVVASTSSYSRQMT----------------WANAPEFVPRYKANS---------AD 83
                  |.:.:|..    .|.:|                ..:.|:..|..|.:|         .|
Mouse    97 NEPGKREKKTLVLR----DRNLTGLAEDKTPPSKVNNPGGCSDPQTSPEMKPHSYLDAIRTGLDD 157

  Fly    84 FQATEGVQD---ICPY--GGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHE 143
            .:|:....:   :|||  .|.|.:|..|.| ||.::|::|.|..|||.|..||:||.:.|:...|
Mouse   158 LEASSSYSNEPQLCPYAAAGECRFGDACVY-LHGDMCEICRLQVLHPFDPEQRKAHEKMCMSTFE 221

  Fly   144 QAMELSFAIARSKDKMCGICFDTVVEK-KGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTR 207
            ..||.:||...|:||:|.||.:.::|| ...||||||||.|.|.:||:|||.||.|.|||..:.:
Mouse   222 HEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCSHTYCLSCIRQWRCAKQFENPIIK 286

  Fly   208 GCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            .||||||.||||.||.|||:.:.:|::|:..::..||.|.||||..|.|.||||:||.|||
Mouse   287 SCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRH 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 9/25 (36%)
PHA03096 <80..239 CDD:222981 76/174 (44%)
RING 159..213 CDD:238093 30/55 (55%)
Mkrn2NP_075779.2 ZnF_C3H1 2..28 CDD:214632
ZnF_C3H1 35..55 CDD:214632 8/20 (40%)
PHA03096 <178..327 CDD:222981 72/150 (48%)
Makorin-type Cys-His 193..222 13/29 (45%)
RING 238..292 CDD:238093 30/54 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1039
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3158
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 1 1.000 T131036
orthoMCL 1 0.900 OOG5_129951
Panther 1 1.100 O PTHR11224
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2178
TreeFam 1 0.960
109.850

Return to query results.
Submit another query.