DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and Mkrn1

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_061280.2 Gene:Mkrn1 MGIID:1859353 Length:481 Species:Mus musculus

Alignment Length:353 Identity:132/354 (37%)
Similarity:174/354 (49%) Gaps:76/354 (21%)


  Fly     7 QTICRFHLLGICRFGDLCRFSHD---------------------ETTPNDNQSP--QISEIADEV 48
            |..||:.:.|:|:.||.||:|||                     :....::..|  |....|.::
Mouse    58 QVTCRYFMHGVCKEGDNCRYSHDLSDSPYGVVCKYFQRGYCVYGDRCRYEHSKPLKQEEVTATDL 122

  Fly    49 VENEQVVASTS---------------SYSRQMT----------WANAPEFVP--RYKANSA---- 82
            .....:.||:|               :.||..:          |.||.||||  .|...:|    
Mouse   123 SAKPSLAASSSLSSGVGSLAEMNSGEAESRNPSFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCT 187

  Fly    83 ---------------DFQATEGVQDICPYG--GSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQ 130
                           :....|..:.:|||.  |.|.:|..|.| ||.:.|.||.|..|||:|..|
Mouse   188 EVPPQGSVTKEESEKEPTTVETKKQLCPYAAVGECRYGENCVY-LHGDSCDMCGLQVLHPVDAAQ 251

  Fly   131 RRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKG-RERRFGILSKCKHIFCLTCIRT 194
            |..|.:.|:|.||:.||||||:.||||.:||||.:.|.||.. .||||||||.|.|.:||.|||.
Mouse   252 RSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRK 316

  Fly   195 WRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCP 259
            ||.|.|||:.:.:.|||||:.|.||.||..||:.||||.||:.:|:.||..|.|:||:.|.|.||
Mouse   317 WRSAKQFESKIIKSCPECRITSNFVIPSENWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCP 381

  Fly   260 FGNKCFYRH---HRRCDDNQTQSNAVNS 284
            ||..|||:|   ..|.::.|.|....:|
Mouse   382 FGGNCFYKHAYPDGRREEPQRQKVGTSS 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 12/44 (27%)
PHA03096 <80..239 CDD:222981 83/181 (46%)
RING 159..213 CDD:238093 32/55 (58%)
Mkrn1NP_061280.2 ZnF_C3H1 55..81 CDD:214632 12/23 (52%)
ZnF_C3H1 88..110 CDD:214632 0/22 (0%)
PHA03096 <221..370 CDD:222981 81/150 (54%)
Makorin-type Cys-His 236..263 13/27 (48%)
RING 281..335 CDD:238093 32/54 (59%)
MKRN1_C 400..479 CDD:292443 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1039
Hieranoid 1 1.000
Homologene 1 1.000 H32175
Inparanoid 1 1.050 254 1.000 Inparanoid score I3158
Isobase 1 0.950 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1388677at2759
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 1 1.000 T131036
orthoMCL 1 0.900 OOG5_129951
Panther 1 1.100 O PTHR11224
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2178
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.