DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5347 and mkrn2

Sequence 1:NP_572970.1 Gene:CG5347 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001005447.1 Gene:mkrn2 XenbaseID:XB-GENE-5879487 Length:418 Species:Xenopus tropicalis

Alignment Length:320 Identity:113/321 (35%)
Similarity:158/321 (49%) Gaps:61/321 (19%)


  Fly     5 RSQTICRFHLLGICRFGDLCRFSHD-------------------ETT----PNDNQSPQISEIAD 46
            :..|:|||:..|.|.:|..||:.|.                   |:|    |....:..:::.|.
 Frog    32 KPSTVCRFYQRGQCAYGARCRYDHVKPCNGSVFYPPQEMAPAPLESTPPLLPTQEAAAPVTKSAP 96

  Fly    47 EVVENEQVVASTSSYSRQMTWANA------PEFVPRYKANS--ADFQA----------------- 86
            :..|.:.||..    .|.:..|:.      |...|...|:.  ::.:|                 
 Frog    97 QRREKKSVVLR----DRDLCGASVEKAHPDPALRPGCAADPPVSELEAKPHSYLEAICTGLDETP 157

  Fly    87 -----TEGVQDICPY--GGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQ 144
                 .:..|.:||:  .|.|.:|..|.| :|..:|::|.|..|||.||.||..|.:.|:...|:
 Frog   158 IPSAYPDAPQQLCPFAQAGGCHYGESCPY-IHGNVCEICGLQVLHPYDQEQRGHHEKLCMANFER 221

  Fly   145 AMELSFAIARSKDKMCGICFDTVVEKKG-RERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRG 208
            .||.:||...|:.|:|.||.:.|.:|:. .||||||||.|.|.:||.|||.||.|.|||..|.:.
 Frog   222 DMERAFAFQASEGKVCSICMERVYDKQSPSERRFGILSNCHHTYCLACIRQWRCARQFENPVIKS 286

  Fly   209 CPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            ||||||.||||.||||||:.:.:|.:|:..::..||.|.||||:.|.|.||||.||.|.|
 Frog   287 CPECRVISEFVIPSAYWVEDQSKKFELIEAFKQGMGKKACKYFDQGRGTCPFGGKCLYLH 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 10/44 (23%)
PHA03096 <80..239 CDD:222981 74/186 (40%)
RING 159..213 CDD:238093 31/55 (56%)
mkrn2NP_001005447.1 YTH1 <5..>80 CDD:227416 12/48 (25%)
PHA02929 <178..310 CDD:331986 67/133 (50%)
Makorin-type Cys-His. {ECO:0000255} 192..221 13/29 (45%)
RING-HC_MKRN2 234..291 CDD:319645 32/57 (56%)
RING-HC finger (C3HC4-type) 237..290 CDD:319645 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1039
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I3209
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000573
OrthoInspector 1 1.000 T129315
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2178
TreeFam 1 0.960
87.850

Return to query results.
Submit another query.